This is header section in file KinMutBase.html After this comes data section. // ID ZAP; ; S518R; c1763a Accession K40 Date 5-Mar-1998 (Rel. 1, Created) Date 5-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Chan A, Kadlecek TA, Elder ME, Filipovich AH, Kuo W-L, RefAuthors Iwashima M, Parslow TG, Weiss A. RefTitle "ZAP-70 deficiecy in an autosomal recessive form of severe RefTitle combined immunodeficiency". RefLoc Science 264:1599-1601 Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: L05148; g340038; 1763 Feature /codon: agc -> aga; 3 Feature /RC: -AciI, -CviJI, +HgaI, -TauI, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P43403; 518 Feature /change: S -> R Feature /domain: TK // ID ZAP; ; KWYAP504PNASTSASSPAAAMSGAMGSPCGRPCPTARSPTRR*; aagtggtacgcac1719 Accession K41 Date 5-Mar-1998 (Rel. 1, Created) Date 5-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Elder ME, Lin D, Clever J, Chan AC, Hope TJ, Weiss A, RefAuthors Parslow TG. RefTitle "Human severe combined immunodeficiency due to a defect in RefTitle ZAP-70, a T cell tyrosine kinase". RefLoc Science 264:1596-1599 (1994) Feature rna; 1 Feature /aalink; 2 Feature /name: frameshift Feature /loc EMBL: L05148; g340038; 1719..1731 Feature /codon: aag -> -; 1 Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: out-of-frame extension Feature /loc SWISSPROT: P43403; 504..508 Feature /change: KWYAP -> PNASTSASSPAAAMSGAMGSPCGRPCPTARSPTRR* Feature /domain: TK // ID TGR2; ; R537P; g1945c Accession K331 Date 29-Sep-1999 (Rel. 1, Created) Date 29-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Garrigue-Antar L, Munoz-Antonia T, Antonia SJ, Gesmonde J, Vellucci VF, Reiss M RefTitle "Missense mutations of the transforming Growth factor B type II receptor in human head and neck squamus carcinoma cells". RefLoc Cancer Research 55:3982-3987 (1995) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 1945 Feature /codon: cgc -> ccc; 2 Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 537 Feature /change: R -> P Feature /domain: TK // ID TGR2; ; E526Q; g1911c Accession K332 Date 29-Sep-1999 (Rel. 1, Created) Date 29-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Garrigue-Antar L, Munoz-Antonia T, Antonia SJ, Gesmonde J, Vellucci VF, Reiss M RefTitle "Missense mutations of the transforming Growth factor B type II receptor in human head and neck squamus carcinoma cells". RefLoc Cancer Research 55:3982-3987 (1995) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 1911 Feature /codon: gag -> cag; 1 Feature /RC: +RleAI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 526 Feature /change: E -> Q Feature /domain: TK // ID RIBOSOMAL PROTEIN S6 KINASE II ALPHA 3; RSK2; ; S227A; t679g Accession K318 Date 29-Sep-1999 (Rel. 1, Created) Date 29-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Trivier E, De Cesare D, Jacquot S, Pannetier S, Zackai E, Young I, Mandel J-L, Sassone-Corsi P, Hanauer A RefTitle "Mutations in the Rsk-2 associated with Coffin-Lowry syndrome". RefLoc Nature 384:567-570 (1996). Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 679 Feature /codon: tct -> gct; 1 Feature /RC: +FauNDI, +NdeI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P51812; 227 Feature /change: S -> A Feature /domain: TK 1 // ID RIBOSOMAL PROTEIN S6 KINASE II ALPHA 3; RSK2; ; G75V; g224t Accession K317 Date 29-Sep-1999 (Rel. 1, Created) Date 29-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Trivier E, De Cesare D, Jacquot S, Pannetier S, Zackai E, Young I, Mandel J-L, Sassone-Corsi P, Hanauer A RefTitle "Mutations in the Rsk-2 associated with Coffin-Lowry syndrome". RefLoc Nature 384:567-570 (1996). Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 224 Feature /codon: ggg -> gtg; 2 Feature /RC: +BsgI, +CviRI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P51812; 75 Feature /change: G -> V Feature /domain: TK 1 // ID RET PROTO-ONCOGENE; RET; ; Y806C; a2566g Accession K310 Date 29-Sep-1999 (Rel. 1, Created) Date 29-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Miyauchi A, Futami H, Hai N, Yokozawa T, Kuma K, Aoki N, Kosugi S, Sugano K, Yamaguchi K RefTitle "Two germline missense mutations at codons 804 and 806 of the RET proto-oncogene in the RefTitle same allele in a patient with multiple endocrine neoplasia type 2B without codon 918 mutation" RefLoc Japanese Jornal of Cancer research 90:105 (1999) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 2566 Feature /codon: tac -> tgc; 2 Feature /RC: -AfaI, +AspLEI, +CfoI, -Csp6I, +HhaI, +Hin6I, Feature /RC: +HinP1I, +HspAI, -RsaI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P07949; 806 Feature /change: Y -> C Feature /domain: TK // ID RET PROTO-ONCOGENE; RET; ; Y806C; a2566g Accession K309 Date 29-Sep-1999 (Rel. 1, Created) Date 29-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Miyauchi A, Futami H, Hai N, Yokozawa T, Kuma K, Aoki N, Kosugi S, Sugano K, Yamaguchi K RefTitle "Two germline missense mutations at codons 804 and 806 of the RET proto-oncogene in the RefTitle same allele in a patient with multiple endocrine neoplasia type 2B without codon 918 mutation" RefLoc Japanese Jornal of Cancer research 90:105 (1999) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 2566 Feature /codon: tac -> tgc; 2 Feature /RC: -AfaI, +AspLEI, +CfoI, -Csp6I, +HhaI, +Hin6I, Feature /RC: +HinP1I, +HspAI, -RsaI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P07949; 806 Feature /change: Y -> C Feature /domain: TK // ID RET PROTO-ONCOGENE; RET; ; Y806C; a2566g Accession K308 Date 29-Sep-1999 (Rel. 1, Created) Date 29-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Miyauchi A, Futami H, Hai N, Yokozawa T, Kuma K, Aoki N, Kosugi S, Sugano K, Yamaguchi K RefTitle "Two germline missense mutations at codons 804 and 806 of the RET proto-oncogene in the RefTitle same allele in a patient with multiple endocrine neoplasia type 2B without codon 918 mutation" RefLoc Japanese Jornal of Cancer research 90:105 (1999) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 2566 Feature /codon: tac -> tgc; 2 Feature /RC: -AfaI, +AspLEI, +CfoI, -Csp6I, +HhaI, +Hin6I, Feature /RC: +HinP1I, +HspAI, -RsaI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P07949; 806 Feature /change: Y -> C Feature /domain: TK // ID RET PROTO-ONCOGENE; RET; ; Y791F; a2521t Accession K313 Date 29-Sep-1999 (Rel. 1, Created) Date 29-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Berndt I, Reuter M, Saller B, Frank-Raue K, Groth P, Grussendorf M, Raue F, Ritter MM, Hoppner W RefTitle "A new hot spot for mutations in the ret protooncogene causing familiar medullary RefTitle thyroid carcinoma and multiple endocrine neoplasia type 2A" RefLoc Journal of Clinical Endocrinology and Metabolism 83(3):770-774. Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 2521 Feature /codon: tat -> ttt; 2 Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P07949; 791 Feature /change: Y -> F Feature /domain: TK // ID RET PROTO-ONCOGENE; RET; ; S891A; t2820g Accession K314 Date 29-Sep-1999 (Rel. 1, Created) Date 29-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Dang GT, Cote GJ, Schultz, PN, Khorana, S, Decker RA, Gagel RF RefTitle "A codon 891 exon 15 RET proto-oncogene mutation in familiar medullary thyroid carcinoma: a detection strategy". RefLoc Molecular and Cellular Probes 13:77-79 (1999). Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 2820 Feature /codon: tcg -> gcg; 1 Feature /RC: -Hpy188IX, Feature /occurrence: 3/3 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P07949; 891 Feature /change: S -> A Feature /domain: TK // ID RET PROTO-ONCOGENE; RET; ; P766S; c2445t Accession K315 Date 29-Sep-1999 (Rel. 1, Created) Date 29-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Uchino S, Noguchi S, Adachi M, Sato M, Yamashita H, Watanabe S, Murakami T, Toda M, Murakami N, Yamashita T RefTitle "Novel point mutations and allele loss at the RET locus in sporadic medullary thyroid carcinomas". RefLoc Japanese Journal of Cancer research 89:411-418 (1998) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 2445 Feature /codon: ccg -> tcg; 1 Feature /RC: +PaeR7I, +Sfr274I, +SmlI, -Sth132I, +TaqI, +TliI, Feature /RC: +TthHB8I, +XhoI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P07949; 766 Feature /change: P -> S Feature /domain: TK // ID RET PROTO-ONCOGENE; RET; ; L790F; g2519t Accession K311 Date 29-Sep-1999 (Rel. 1, Created) Date 29-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Berndt I, Reuter M, Saller B, Frank-Raue K, Groth P, Grussendorf M, Raue F, Ritter MM, Hoppner W RefTitle "A new hot spot for mutations in the ret protooncogene causing familiar medullary RefTitle thyroid carcinoma and multiple endocrine neoplasia type 2A" RefLoc Journal of Clinical Endocrinology and Metabolism 83(3):770-774. Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 2519 Feature /codon: ttg -> ttt; 3 Feature /RC: +AcsI, +ApoI, +XapI, Feature /occurrence: 3/12 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P07949; 790 Feature /change: L -> F Feature /domain: TK // ID RET PROTO-ONCOGENE; RET; ; L790F; g2519c Accession K312 Date 29-Sep-1999 (Rel. 1, Created) Date 29-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Berndt I, Reuter M, Saller B, Frank-Raue K, Groth P, Grussendorf M, Raue F, Ritter MM, Hoppner W RefTitle "A new hot spot for mutations in the ret protooncogene causing familiar medullary RefTitle thyroid carcinoma and multiple endocrine neoplasia type 2A" RefLoc Journal of Clinical Endocrinology and Metabolism 83(3):770-774. Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 2519 Feature /codon: ttg -> ttc; 3 Feature /RC: +AcsI, +ApoI, +XapI, Feature /occurrence: 1/6 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P07949; 790 Feature /change: L -> F Feature /domain: TK // ID RET PROTO-ONCOGENE; RET; ; A919V; c2905t Accession K316 Date 29-Sep-1999 (Rel. 1, Created) Date 29-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Uchino S, Noguchi S, Adachi M, Sato M, Yamashita H, Watanabe S, Murakami T, Toda M, Murakami N, Yamashita T RefTitle "Novel point mutations and allele loss at the RET locus in sporadic medullary thyroid carcinomas". RefLoc Japanese Journal of Cancer research 89:411-418 (1998) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 2905 Feature /codon: gca -> gta; 2 Feature /RC: -MfeI, -MunI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P07949; 919 Feature /change: A -> V Feature /domain: TK // ID LKB1; ; P281RSLTC*; c842 Accession K327 Date 29-Sep-1999 (Rel. 1, Created) Date 29-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Dong SM, Kim KM, Kim SY, Shin MS, Na EY, Lee SH, Park WS, RefAuthors Yoo NJ, Jang JJ, Yoon CY, Kim JW, Kim SY, Yang YM, Kim SH, Kim CS, Lee JY RefTitle "Frequent somatic mutations in serine/threonine kinase11/Peutz-Jeghers syndrome gene in left-sided colon cancer" RefLoc Cancer Research 58:3787-3790 (1998) refNumber 2 RefAuthors Nakagawa H, Koyama K, Miyoshi Y, Ando H, Baba S, Watanami M, Yasutomi M, Matsuura N, Monden M, Nakamura Y RefTitle "Nine novel germline mutations of STK11 in ten families with Peutz-Jeghers syndrome" RefLoc Human Genetics 103:168-172 (1998) Feature rna; 1 Feature /aalink; 2 Feature /name: frameshift Feature /loc EMBL: ; ; 842 Feature /codon: ccg -> -; 2 Feature /occurrence: 2/2 Feature aa; 2 Feature /rnalink: 1 Feature /name: out-of-frame extension Feature /loc SWISSPROT: ; 281 Feature /change: P -> RSLTC* Feature /domain: TK // ID LKB1; ; P281PPAL*; c842c Accession K323 Date 29-Sep-1999 (Rel. 1, Created) Date 29-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Nakagawa H, Koyama K, Miyoshi Y, Ando H, Baba S, Watanami M, Yasutomi M, Matsuura N, Monden M, Nakamura Y RefTitle "Nine novel germline mutations of STK11 in ten families with Peutz-Jeghers syndrome" RefLoc Human Genetics 103:168-172 (1998) Feature rna; 1 Feature /aalink; 2 Feature /name: frameshift Feature /loc EMBL: ; ; 842 Feature /codon: ccg -> -; 2 Feature /occurrence: 2/2 Feature aa; 2 Feature /rnalink: 1 Feature /name: out-of-frame extension Feature /loc SWISSPROT: ; 281 Feature /change: P -> PPAL* Feature /domain: TK // ID LKB1; ; P281L; c842t Accession K325 Date 29-Sep-1999 (Rel. 1, Created) Date 29-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Dong SM, Kim KM, Kim SY, Shin MS, Na EY, Lee SH, Park WS, RefAuthors Yoo NJ, Jang JJ, Yoon CY, Kim JW, Kim SY, Yang YM, Kim SH, Kim CS, Lee JY RefTitle "Frequent somatic mutations in serine/threonine kinase11/Peutz-Jeghers syndrome gene in left-sided colon cancer" RefLoc Cancer Research 58:3787-3790 (1998) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 842 Feature /codon: ccg -> ctg; 2 Feature /RC: -AccBSI, -AciI, -BsrBI, -FauI, -MbiI, -Sth132I, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 281 Feature /change: P -> L Feature /domain: TK // ID LKB1; ; N247; aac739 Accession K321 Date 29-Sep-1999 (Rel. 1, Created) Date 29-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Nakagawa H, Koyama K, Miyoshi Y, Ando H, Baba S, Watanami M, Yasutomi M, Matsuura N, Monden M, Nakamura Y RefTitle "Nine novel germline mutations of STK11 in ten families with Peutz-Jeghers syndrome" RefLoc Human Genetics 103:168-172 (1998) Feature rna; 1 Feature /aalink; 2 Feature /name: inframe Feature /loc EMBL: ; ; 739..741 Feature /codon: aac -> -; 1 Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: deletion Feature /loc SWISSPROT: ; 247 Feature /change: N -> Feature /domain: TK // ID LKB1; ; L245LTTSPRVCTPSKGTTSTSCLRTSGRGATPSRATVAPRSLTC*; c735 Accession K320 Date 29-Sep-1999 (Rel. 1, Created) Date 29-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Nakagawa H, Koyama K, Miyoshi Y, Ando H, Baba S, Watanami M, Yasutomi M, Matsuura N, Monden M, Nakamura Y RefTitle "Nine novel germline mutations of STK11 in ten families with Peutz-Jeghers syndrome" RefLoc Human Genetics 103:168-172 (1998) Feature rna; 1 Feature /aalink; 2 Feature /name: frameshift Feature /loc EMBL: ; ; 735 Feature /codon: ctc -> -; 3 Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: out-of-frame extension Feature /loc SWISSPROT: ; 245 Feature /change: L -> LTTSPRVCTPSKGTTSTSCLRTSGRGATPSRATVAPRSLTC* Feature /domain: TK // ID LKB1; ; L140WTACRRSVSQCARPTGTSVS*; c418 Accession K319 Date 29-Sep-1999 (Rel. 1, Created) Date 29-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Nakagawa H, Koyama K, Miyoshi Y, Ando H, Baba S, Watanami M, Yasutomi M, Matsuura N, Monden M, Nakamura Y RefTitle "Nine novel germline mutations of STK11 in ten families with Peutz-Jeghers syndrome" RefLoc Human Genetics 103:168-172 (1998) Feature rna; 1 Feature /aalink; 2 Feature /name: frameshift Feature /loc EMBL: ; ; 418 Feature /codon: ctg -> -; 1 Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: out-of-frame extension Feature /loc SWISSPROT: ; 140 Feature /change: L -> WTACRRSVSQCARPTGTSVS* Feature /domain: TK // ID LKB1; ; G215D; g644a Accession K328 Date 29-Sep-1999 (Rel. 1, Created) Date 29-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Dong SM, Kim KM, Kim SY, Shin MS, Na EY, Lee SH, Park WS, RefAuthors Yoo NJ, Jang JJ, Yoon CY, Kim JW, Kim SY, Yang YM, Kim SH, Kim CS, Lee JY RefTitle "Frequent somatic mutations in serine/threonine kinase11/Peutz-Jeghers syndrome gene in left-sided colon cancer" RefLoc Cancer Research 58:3787-3790 (1998) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 644 Feature /codon: ggc -> gac; 2 Feature /RC: -BanII, -BscBI, -BspLI, -Eco24I, -EcoT38I, -FriOI, Feature /RC: -HgiJII, +HinfI, -NlaIV, -PspN4I, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 215 Feature /change: G -> D Feature /domain: TK // ID LKB1; ; G171S; g511a Accession K330 Date 29-Sep-1999 (Rel. 1, Created) Date 29-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Dong SM, Kim KM, Kim SY, Shin MS, Na EY, Lee SH, Park WS, RefAuthors Yoo NJ, Jang JJ, Yoon CY, Kim JW, Kim SY, Yang YM, Kim SH, Kim CS, Lee JY RefTitle "Frequent somatic mutations in serine/threonine kinase11/Peutz-Jeghers syndrome gene in left-sided colon cancer" RefLoc Cancer Research 58:3787-3790 (1998) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 511 Feature /codon: ggc -> agc; 1 Feature /RC: -Bme1390I, -BsaJI, -BseDI, -BsiLI, -BssECI, -BssKI, Feature /RC: -BstNI, -BstOI, -Bst2UI, -EcoRII, -MspR9I, -MvaI, Feature /RC: -PspGI, -ScrFI, -SecI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 171 Feature /change: G -> S Feature /domain: TK // ID LKB1; ; G171S; g511a Accession K324 Date 29-Sep-1999 (Rel. 1, Created) Date 29-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Dong SM, Kim KM, Kim SY, Shin MS, Na EY, Lee SH, Park WS, RefAuthors Yoo NJ, Jang JJ, Yoon CY, Kim JW, Kim SY, Yang YM, Kim SH, Kim CS, Lee JY RefTitle "Frequent somatic mutations in serine/threonine kinase11/Peutz-Jeghers syndrome gene in left-sided colon cancer" RefLoc Cancer Research 58:3787-3790 (1998) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 511 Feature /codon: ggc -> agc; 1 Feature /RC: -Bme1390I, -BsaJI, -BseDI, -BsiLI, -BssECI, -BssKI, Feature /RC: -BstNI, -BstOI, -Bst2UI, -EcoRII, -MspR9I, -MvaI, Feature /RC: -PspGI, -ScrFI, -SecI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 171 Feature /change: G -> S Feature /domain: TK // ID LKB1; ; E199K; g595a Accession K329 Date 29-Sep-1999 (Rel. 1, Created) Date 29-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Dong SM, Kim KM, Kim SY, Shin MS, Na EY, Lee SH, Park WS, RefAuthors Yoo NJ, Jang JJ, Yoon CY, Kim JW, Kim SY, Yang YM, Kim SH, Kim CS, Lee JY RefTitle "Frequent somatic mutations in serine/threonine kinase11/Peutz-Jeghers syndrome gene in left-sided colon cancer" RefLoc Cancer Research 58:3787-3790 (1998) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 595 Feature /codon: gag -> aag; 1 Feature /RC: +BalI, +BssT1I, +Eco130I, +EcoT14I, +ErhI, +HaeI, Feature /RC: +MlsI, +MluNI, +MscI, +StyI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 199 Feature /change: E -> K Feature /domain: TK // ID LKB1; ; D208N; g622a Accession K326 Date 29-Sep-1999 (Rel. 1, Created) Date 29-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Dong SM, Kim KM, Kim SY, Shin MS, Na EY, Lee SH, Park WS, RefAuthors Yoo NJ, Jang JJ, Yoon CY, Kim JW, Kim SY, Yang YM, Kim SH, Kim CS, Lee JY RefTitle "Frequent somatic mutations in serine/threonine kinase11/Peutz-Jeghers syndrome gene in left-sided colon cancer" RefLoc Cancer Research 58:3787-3790 (1998) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 622 Feature /codon: gac -> aac; 1 Feature /RC: +BsbI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 208 Feature /change: D -> N Feature /domain: TK // ID ANGIOPOIETIN 1 RECEPTOR; TIE2; ; R849W; c2693t Accession K66 Date 19-Sep-1999 (Rel. 1, Created) Date 19-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Vikkula M, Boon LM, Carraway KL III, Calvert JT, Diamonti AD, RefAuthors Goumnerov B, Pasyk KA, Marchuk DA, Warman ML, Cantley LC, Mulliken JB, Olsen BR. RefTitle "Vascular Dysmorphogenesis Caused by an Activating Mutation RefTitle in the Receptor Tyrosine Kinase TIE2". RefLoc Cell 87:1181-1190 (1996). Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 2693 Feature /codon: cgg -> tgg; 1 Feature /RC: +CjePI, -MaeIII, Feature /occurrence: 2/65 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 849 Feature /change: R -> W Feature /domain: TK // ID TGR2; ; T458A; a1707g Accession K61 Date 22-Aug-1999 (Rel. 1, Created) Date 22-Aug-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Yasumi K., Guo R-J., Hanai H., Arai H., Konno H., Takenoshita S., Hagiwara K., Sugimura H. RefTitle "Transforming growth factor B type II receptor (TGFBRII) mutation in gastric lymphoma without mutator phenotype." RefLoc Pathology International 48:134-137 (1998). Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 1707 Feature /codon: aca -> gca; 1 Feature /RC: +SfaNI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 458 Feature /change: T -> A Feature /domain: TK // ID TGR2; ; T315M; c1279t Accession K63 Date 22-Aug-1999 (Rel. 1, Created) Date 22-Aug-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Lu S-L., Kawabata M., Imamura T., Akiyama Y., Nomizu T., Miyazono K., Yuasa Y. RefTitle "HNPCC associated with germline mutation in the TGF-B type II receptor gene" RefLoc Nature Genetics 19:17-18, (1998). Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 1279 Feature /codon: acg -> atg; 2 Feature /RC: -BbsI, -BbvII, -BpiI, -BpuAI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 315 Feature /change: T -> M Feature /domain: TK // ID TGR2; ; D405G; a1549g Accession K62 Date 22-Aug-1999 (Rel. 1, Created) Date 22-Aug-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Knaus P.I., Lindemann D., DeCoteau J.F., Perlman R., Yankelev H., Hille M., Kadin M.E., Lodish H.F. RefTitle "A dominant inhibitory mutant of the type III transforming growth factor B receptor in the malignant progression of a cutaneus T-cell lymphoma" RefLoc Molecular and Cellular Biology 16(7):3480-3489 (1996). Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 1549 Feature /codon: gac -> ggc; 2 Feature /RC: +ApaI, -AvaII, +BanII, -Bme18I, +BmgI, +BseSI, Feature /RC: +BshI, +Bsp120I, -BspGI, +BsuRI, +CviJI, +CviTI, Feature /RC: +DraII, +Eco24I, -Eco47I, +EcoO109I, +EcoT38I, +FriOI, Feature /RC: +HaeIII, -HgiEI, +HgiJII, -Hpy178III, +PalI, +PspOMI, Feature /RC: -SinI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 405 Feature /change: D -> G Feature /domain: TK // ID RIBOSOMAL PROTEIN S6 KINASE II ALPHA 3; RSK2; ; W645*; g1934a Accession K307 Date 27-Sep-1999 (Rel. 1, Created) Date 27-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Jacquot S, Merienne K, De Cesare D, Pannetier S, Mandel J-L, Sassone-Corsi P, Hanauer A RefTitle "Mutation analysis of the RSK2 gene in Coffin-Lowry Patients: extensive allelic heterogeneity and a high rate of de novo mutations". RefLoc American Journal of Human Genetics 63:1631-1640 (1998). Feature rna; 1 Feature /aalink; 2 Feature /name: nonsense Feature /loc EMBL: ; ; 1934 Feature /codon: tgg -> tag; 2 Feature /RC: +BfaI, -Bse1I, -BseNI, -BsrI, -BsrSI, +MaeI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: premature termination Feature /loc SWISSPROT: P51812; 645 Feature /change: W -> * Feature /domain: TK 2 // ID RIBOSOMAL PROTEIN S6 KINASE II ALPHA 3; RSK2; ; V82F; g244t Accession K294 Date 27-Sep-1999 (Rel. 1, Created) Date 27-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Jacquot S, Merienne K, De Cesare D, Pannetier S, Mandel J-L, Sassone-Corsi P, Hanauer A RefTitle "Mutation analysis of the RSK2 gene in Coffin-Lowry Patients: extensive allelic heterogeneity and a high rate of de novo mutations". RefLoc American Journal of Human Genetics 63:1631-1640 (1998). Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 244 Feature /codon: gtt -> ttt; 1 Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P51812; 82 Feature /change: V -> F Feature /domain: TK 1 // ID RIBOSOMAL PROTEIN S6 KINASE II ALPHA 3; RSK2; ; R558*; c1672t Accession K306 Date 27-Sep-1999 (Rel. 1, Created) Date 27-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Jacquot S, Merienne K, De Cesare D, Pannetier S, Mandel J-L, Sassone-Corsi P, Hanauer A RefTitle "Mutation analysis of the RSK2 gene in Coffin-Lowry Patients: extensive allelic heterogeneity and a high rate of de novo mutations". RefLoc American Journal of Human Genetics 63:1631-1640 (1998). Feature rna; 1 Feature /aalink; 2 Feature /name: nonsense Feature /loc EMBL: ; ; 1672 Feature /codon: cga -> tga; 1 Feature /RC: -Asp700I, -AsuII, -Bpu14I, -BsiCI, -Bsp119I, -BstBI, Feature /RC: -CbiI, -Csp45I, -LspI, -MroXI, -NspV, -SfuI, Feature /RC: -TaqI, -TthHB8I, -XmnI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: premature termination Feature /loc SWISSPROT: P51812; 558 Feature /change: R -> * Feature /domain: TK 2 // ID RIBOSOMAL PROTEIN S6 KINASE II ALPHA 3; RSK2; ; R514*; c1540t Accession K305 Date 27-Sep-1999 (Rel. 1, Created) Date 27-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Jacquot S, Merienne K, De Cesare D, Pannetier S, Mandel J-L, Sassone-Corsi P, Hanauer A RefTitle "Mutation analysis of the RSK2 gene in Coffin-Lowry Patients: extensive allelic heterogeneity and a high rate of de novo mutations". RefLoc American Journal of Human Genetics 63:1631-1640 (1998). Feature rna; 1 Feature /aalink; 2 Feature /name: nonsense Feature /loc EMBL: ; ; 1540 Feature /codon: cga -> tga; 1 Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: premature termination Feature /loc SWISSPROT: P51812; 514 Feature /change: R -> * Feature /domain: TK 2 // ID RIBOSOMAL PROTEIN S6 KINASE II ALPHA 3; RSK2; ; R305*; c913t Accession K303 Date 27-Sep-1999 (Rel. 1, Created) Date 27-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Jacquot S, Merienne K, De Cesare D, Pannetier S, Mandel J-L, Sassone-Corsi P, Hanauer A RefTitle "Mutation analysis of the RSK2 gene in Coffin-Lowry Patients: extensive allelic heterogeneity and a high rate of de novo mutations". RefLoc American Journal of Human Genetics 63:1631-1640 (1998). Feature rna; 1 Feature /aalink; 2 Feature /name: nonsense Feature /loc EMBL: ; ; 913 Feature /codon: cga -> tga; 1 Feature /RC: -MwoI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: premature termination Feature /loc SWISSPROT: P51812; 305 Feature /change: R -> * Feature /domain: TK 1 // ID RIBOSOMAL PROTEIN S6 KINASE II ALPHA 3; RSK2; ; R273*; c817t Accession K302 Date 27-Sep-1999 (Rel. 1, Created) Date 27-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Jacquot S, Merienne K, De Cesare D, Pannetier S, Mandel J-L, Sassone-Corsi P, Hanauer A RefTitle "Mutation analysis of the RSK2 gene in Coffin-Lowry Patients: extensive allelic heterogeneity and a high rate of de novo mutations". RefLoc American Journal of Human Genetics 63:1631-1640 (1998). Feature rna; 1 Feature /aalink; 2 Feature /name: nonsense Feature /loc EMBL: ; ; 817 Feature /codon: cga -> tga; 1 Feature /RC: -BscFI, -Bsp143I, -DpnI, -DpnII, -Kzo9I, -MboI, Feature /RC: -NdeII, -Sau3AI, -TaqI, -TthHB8I, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: premature termination Feature /loc SWISSPROT: P51812; 273 Feature /change: R -> * Feature /domain: TK 1 // ID RIBOSOMAL PROTEIN S6 KINASE II ALPHA 3; RSK2; ; R112*; c334t Accession K299 Date 27-Sep-1999 (Rel. 1, Created) Date 27-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Jacquot S, Merienne K, De Cesare D, Pannetier S, Mandel J-L, Sassone-Corsi P, Hanauer A RefTitle "Mutation analysis of the RSK2 gene in Coffin-Lowry Patients: extensive allelic heterogeneity and a high rate of de novo mutations". RefLoc American Journal of Human Genetics 63:1631-1640 (1998). Feature rna; 1 Feature /aalink; 2 Feature /name: nonsense Feature /loc EMBL: ; ; 334 Feature /codon: cga -> tga; 1 Feature /RC: +BstDEI, +DdeI, -TaqII, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: premature termination Feature /loc SWISSPROT: P51812; 112 Feature /change: R -> * Feature /domain: TK 1 // ID RIBOSOMAL PROTEIN S6 KINASE II ALPHA 3; RSK2; ; R110*; c328t Accession K298 Date 27-Sep-1999 (Rel. 1, Created) Date 27-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Jacquot S, Merienne K, De Cesare D, Pannetier S, Mandel J-L, Sassone-Corsi P, Hanauer A RefTitle "Mutation analysis of the RSK2 gene in Coffin-Lowry Patients: extensive allelic heterogeneity and a high rate of de novo mutations". RefLoc American Journal of Human Genetics 63:1631-1640 (1998). Feature rna; 1 Feature /aalink; 2 Feature /name: nonsense Feature /loc EMBL: ; ; 328 Feature /codon: cga -> tga; 1 Feature /RC: -Hpy178III, -TaqI, -TthHB8I, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: premature termination Feature /loc SWISSPROT: P51812; 110 Feature /change: R -> * Feature /domain: TK 1 // ID RIBOSOMAL PROTEIN S6 KINASE II ALPHA 3; RSK2; ; M99RRY*; t296 Accession K295 Date 27-Sep-1999 (Rel. 1, Created) Date 27-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Jacquot S, Merienne K, De Cesare D, Pannetier S, Mandel J-L, Sassone-Corsi P, Hanauer A RefTitle "Mutation analysis of the RSK2 gene in Coffin-Lowry Patients: extensive allelic heterogeneity and a high rate of de novo mutations". RefLoc American Journal of Human Genetics 63:1631-1640 (1998). Feature rna; 1 Feature /aalink; 2 Feature /name: frameshift Feature /loc EMBL: ; ; 296 Feature /codon: atg -> -; 2 Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: out-of-frame extension Feature /loc SWISSPROT: P51812; 99 Feature /change: M -> RRY* Feature /domain: TK 1 // ID RIBOSOMAL PROTEIN S6 KINASE II ALPHA 3; RSK2; ; I88SQALMLGSFMP*; a262 Accession K296 Date 27-Sep-1999 (Rel. 1, Created) Date 27-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Jacquot S, Merienne K, De Cesare D, Pannetier S, Mandel J-L, Sassone-Corsi P, Hanauer A RefTitle "Mutation analysis of the RSK2 gene in Coffin-Lowry Patients: extensive allelic heterogeneity and a high rate of de novo mutations". RefLoc American Journal of Human Genetics 63:1631-1640 (1998). Feature rna; 1 Feature /aalink; 2 Feature /name: frameshift Feature /loc EMBL: ; ; 262 Feature /codon: atc -> -; 1 Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: out-of-frame extension Feature /loc SWISSPROT: P51812; 88 Feature /change: I -> SQALMLGSFMP* Feature /domain: TK 1 // ID RIBOSOMAL PROTEIN S6 KINASE II ALPHA 3; RSK2; ; H127Q; t381g Accession K297 Date 27-Sep-1999 (Rel. 1, Created) Date 27-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Jacquot S, Merienne K, De Cesare D, Pannetier S, Mandel J-L, Sassone-Corsi P, Hanauer A RefTitle "Mutation analysis of the RSK2 gene in Coffin-Lowry Patients: extensive allelic heterogeneity and a high rate of de novo mutations". RefLoc American Journal of Human Genetics 63:1631-1640 (1998). Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 381 Feature /codon: cat -> cag; 3 Feature /RC: +CviJI, +CviTI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P51812; 127 Feature /change: H -> Q Feature /domain: TK 1 // ID RIBOSOMAL PROTEIN S6 KINASE II ALPHA 3; RSK2; ; G431D; g1292a Accession K304 Date 27-Sep-1999 (Rel. 1, Created) Date 27-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Jacquot S, Merienne K, De Cesare D, Pannetier S, Mandel J-L, Sassone-Corsi P, Hanauer A RefTitle "Mutation analysis of the RSK2 gene in Coffin-Lowry Patients: extensive allelic heterogeneity and a high rate of de novo mutations". RefLoc American Journal of Human Genetics 63:1631-1640 (1998). Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 1292 Feature /codon: ggc -> gac; 2 Feature /RC: -BscBI, -BspLI, -CviJI, -CviTI, +HincII, +HindII, Feature /RC: +HinfI, +MjaIV, -NlaIV, -PspN4I, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P51812; 431 Feature /change: G -> D Feature /domain: TK 2 // ID RIBOSOMAL PROTEIN S6 KINASE II ALPHA 3; RSK2; ; D154Y; g460t Accession K300 Date 27-Sep-1999 (Rel. 1, Created) Date 27-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Jacquot S, Merienne K, De Cesare D, Pannetier S, Mandel J-L, Sassone-Corsi P, Hanauer A RefTitle "Mutation analysis of the RSK2 gene in Coffin-Lowry Patients: extensive allelic heterogeneity and a high rate of de novo mutations". RefLoc American Journal of Human Genetics 63:1631-1640 (1998). Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 460 Feature /codon: gat -> tat; 1 Feature /RC: -BseRI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P51812; 154 Feature /change: D -> Y Feature /domain: TK 1 // ID RIBOSOMAL PROTEIN S6 KINASE II ALPHA 3; RSK2; ; A225V; c674t Accession K301 Date 27-Sep-1999 (Rel. 1, Created) Date 27-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Jacquot S, Merienne K, De Cesare D, Pannetier S, Mandel J-L, Sassone-Corsi P, Hanauer A RefTitle "Mutation analysis of the RSK2 gene in Coffin-Lowry Patients: extensive allelic heterogeneity and a high rate of de novo mutations". RefLoc American Journal of Human Genetics 63:1631-1640 (1998). Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 674 Feature /codon: gca -> gta; 2 Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P51812; 225 Feature /change: A -> V Feature /domain: TK 1 // ID RET PROTO-ONCOGENE; RET; ; Y791F; a2521t Accession K48 Date 5-Mar-1998 (Rel. 1, Created) Date 5-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Attie T, Pelet A, Edery P, Eng C, Mulligan LM, Amiel J, RefAuthors Boutrand L, Beldjord C, Nihoul-Fekete C, Munnich A, Ponder BAJ, RefAuthors Lyonnet S. RefTitle "Diversity of RET proto-oncogene mutations in familial and RefTitle sporadic Hirschprung disease". RefLoc Hum. Mol. Genet. 4(8):1381-1386) (1995) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 2521 Feature /codon: tat -> ttt; 2 Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P07949; 791 Feature /change: Y -> F Feature /domain: TK // ID RET PROTO-ONCOGENE; RET; ; W942Q; g2974a Accession K54 Date 5-Mar-1998 (Rel. 1, Created) Date 5-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Attie T, Pelet A, Edery P, Eng C, Mulligan LM, Amiel J, RefAuthors Boutrand L, Beldjord C, Nihoul-Fekete C, Munnich A, Ponder BAJ, RefAuthors Lyonnet S. RefTitle "Diversity of RET proto-oncogene mutations in familial and RefTitle sporadic Hirschprung disease". RefLoc Hum. Mol. Genet. 4(8):1381-1386) (1995) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 2974 Feature /codon: tgg -> tag; 2 Feature /RC: +BfmI, +BstSFI, +EcoNI, +SfcI, +SfeI, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P07949; 942 Feature /change: W -> Q Feature /domain: TK // ID RET PROTO-ONCOGENE; RET; ; V804M; g2559a Accession K49 Date 5-Mar-1998 (Rel. 1, Created) Date 5-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Fatturuso O, Quadro L, Libroia A, Verga U, Lupoli G, Cascone E, RefAuthors Colantuoni V. RefTitle "RET proto-oncogene in two families affected by familial RefTitle medullary thyroid carcinoma". RefLoc Human mutation online RefNumber 2 RefLoc 72 (1997) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 2559 Feature /codon: gtg -> atg; 1 Feature /RC: +Hsp92II, +NlaIII, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P07949; 804 Feature /change: V -> M Feature /domain: TK // ID RET PROTO-ONCOGENE; RET; ; V804L; g2559t Accession K50 Date 5-Mar-1998 (Rel. 1, Created) Date 5-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Bolino A, Schuffenecker I, Luo Y, Seri M, Silengo M, Tocco T, RefAuthors Chabrier G, Houdent C, Murat A, Sclumberger M, Tourniaire J, RefAuthors Lenoir GM, Romeo G. RefTitle "RET mutations in exons 13 and 14 of FMTC patients". RefLoc Oncogene 10:2415-2419 (1995) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 2559 Feature /codon: gtg -> ttg; 1 Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P07949; 804 Feature /change: V -> L Feature /domain: TK // ID RET PROTO-ONCOGENE; RET; ; S922Y; c2914a Accession K53 Date 5-Mar-1998 (Rel. 1, Created) Date 5-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Kitamura Y, Scavarda N, Wells SA, Jackson CE, Goodfellow PJ. RefTitle "Two maternally derived missense mutations in the tyrosine RefTitle kinase domain of the RET protooncogene in a patient with de RefTitle novo MEN 2B". RefLoc Hum. Mol. Genet. 4(10):1987-1988) (1995) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 2914 Feature /codon: tcc -> tac; 2 Feature /RC: -HinfI, -TfiI, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P07949; 922 Feature /change: S -> Y Feature /domain: TK // ID RET PROTO-ONCOGENE; RET; ; S765P; t2442c Accession K44 Date 5-Mar-1998 (Rel. 1, Created) Date 5-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Romeo G, Ronchetto P, Luo Y, Barone V, Seri M, Ceccherini I, RefAuthors Pasini B, Bocciardi R, Lerone M, Kaariainen H Martuciello G. RefTitle "Point mutations affecting the tyrosine kinase domain of the RefTitle RET proto-oncogene in Hirschprung's disease". RefLoc Nature 367:377-378 (1994) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 2442 Feature /codon: tcc -> ccc; 1 Feature /RC: -BplI, -MnlI, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P07949; 765 Feature /change: S -> P Feature /domain: TK // ID RET PROTO-ONCOGENE; RET; ; R972G; a3063g Accession K46 Date 5-Mar-1998 (Rel. 1, Created) Date 5-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Romeo G, Ronchetto P, Luo Y, Barone V, Seri M, Ceccherini I, RefAuthors Pasini B, Bocciardi R, Lerone M, Kaariainen H Martuciello G. RefTitle "Point mutations affecting the tyrosine kinase domain of the RefTitle RET proto-oncogene in Hirschprung's disease". RefLoc Nature 367:377-378 (1994) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 3063 Feature /codon: agg -> ggg; 1 Feature /RC: +AspS9I, +AsuI, +BscBI, +BsiZI, +BspLI, +Cfr13I, Feature /RC: -HaeI, +NlaIV, +PspN4I, +Sau96I, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P07949; 972 Feature /change: R -> G Feature /domain: TK // ID RET PROTO-ONCOGENE; RET; ; R897Q; g2839a Accession K45 Date 5-Mar-1998 (Rel. 1, Created) Date 5-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Romeo G, Ronchetto P, Luo Y, Barone V, Seri M, Ceccherini I, RefAuthors Pasini B, Bocciardi R, Lerone M, Kaariainen H Martuciello G. RefTitle "Point mutations affecting the tyrosine kinase domain of the RefTitle RET proto-oncogene in Hirschprung's disease". RefLoc Nature 367:377-378 (1994) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 2839 Feature /codon: cga -> caa; 2 Feature /RC: -Ama87I, -AvaI, -BcoI, -BsoBI, -Eco88I, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P07949; 897 Feature /change: R -> Q Feature /domain: TK // ID RET PROTO-ONCOGENE; RET; ; P973L; c3067t Accession K43 Date 5-Mar-1998 (Rel. 1, Created) Date 5-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Yin L, Barone V, Seri M, Bolino A, Bocciardi R, Ceccherini I, RefAuthors Pasini B, Tocco T, Lerone M, Cywes S, Moore S, Vanderwinden JM, RefAuthors Abramowicz MJ, Kristofferson U, Larsson LT, Hamel BCJ, RefAuthors Silengo M, Martuciello G, Romeo G. RefTitle "Heterogeneity and low detection rate of RET mutations in RefTitle Hirschsprung disease". RefLoc Eur. J. Genet. 2:272-280 (1994) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 3067 Feature /codon: cca -> cta; 2 Feature /RC: +BfaI, -BshI, -BsuRI, -HaeI, -HaeIII, +MaeI, Feature /RC: -PalI, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P07949; 973 Feature /change: P -> L Feature /domain: TK // ID RET PROTO-ONCOGENE; RET; ; M918T; t2902c Accession K51 Date 5-Mar-1998 (Rel. 1, Created) Date 5-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Carlson KM, Dou S, Chi D, Scavarda N, Toshima K, Jackson CE, RefAuthors Wells SA, Goodfellow PJ, Donis-Keller H. RefTitle "Single missense mutation in the tyrosine kinase catalytic RefTitle domain of the RET protooncogene is associated withmultiple RefTitle endocrine neoplasia type 2B". RefLoc Pcoc. Natl. Acad. Sci. USA 91:1579-1583 (1994) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 2902 Feature /codon: atg -> acg; 2 Feature /RC: +BcefI, -BseGI, -BstF5I, -FokI, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P07949; 918 Feature /change: M -> T Feature /domain: TK // ID RET PROTO-ONCOGENE; RET; ; E921*; g2910t Accession K52 Date 5-Mar-1998 (Rel. 1, Created) Date 5-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Attie T, Pelet A, Edery P, Eng C, Mulligan LM, Amiel J, RefAuthors Boutrand L, Beldjord C, Nihoul-Fekete C, Munnich A, Ponder BAJ, RefAuthors Lyonnet S. RefTitle "Diversity of RET proto-oncogene mutations in familial and RefTitle sporadic Hirschprung disease". RefLoc Hum. Mol. Genet. 4(8):1381-1386 (1995) Feature rna; 1 Feature /aalink; 2 Feature /name: nonsense Feature /loc EMBL: ; ; 2910 Feature /codon: gaa -> taa; 1 Feature /RC: -HinfI, -MfeI, +MseI, -MunI, -TfiI, +Tru1I, Feature /RC: +Tru9I, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: premature termination Feature /loc SWISSPROT: P07949; 921 Feature /change: E -> * Feature /domain: TK // ID RET PROTO-ONCOGENE; RET; ; E768D; g2453c Accession K47 Date 5-Mar-1998 (Rel. 1, Created) Date 5-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Eng C, Smith DP, Mulligan LM, Healey CS, Zvelebil M, RefAuthors Stonehouse TJ, Ponder MA, Jackson CE, Waterfield MD, Ponder BAJ. RefTitle "A novel point mutation in the tyrosine kinase domain of the RefTitle RET proto-oncogene in sporadic medullary thyroid carcinoma and RefTitle in a family with FMTC". RefLoc Oncogene 10:509-513 (1995) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 2453 Feature /codon: gag -> gac; 3 Feature /RC: -AluI, -CviJI, +MaeIII, +Tsp45I, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P07949; 768 Feature /change: E -> D Feature /domain: TK // ID RET PROTO-ONCOGENE; RET; ; E762Q; g2433c Accession K42 Date 5-Mar-1998 (Rel. 1, Created) Date 5-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Yin L, Barone V, Seri M, Bolino A, Bocciardi R, Ceccherini I, RefAuthors Pasini B, Tocco T, Lerone M, Cywes S, Moore S, Vanderwinden JM, RefAuthors Abramowicz MJ, Kristofferson U, Larsson LT, Hamel BCJ, RefAuthors Silengo M, Martuciello G, Romeo G. RefTitle "Heterogeneity and low detection rate of RET mutations in RefTitle Hirschsprung disease". RefLoc Eur. J. Genet. 2:272-280 (1994) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 2433 Feature /codon: gag -> cag; 1 Feature /RC: -BplI, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P07949; 762 Feature /change: E -> Q Feature /domain: TK // ID PAK3; ; R419*; c1255t Accession K65 Date 19-Sep-1999 (Rel. 1, Created) Date 19-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Allen KM, Gleeson J, Bagrodia S, Partington MW, MacMillan JC RefAuthors Cerione RA, Mulley JC, Walsh CA. RefTitle "PAK3 mutation in nonsyndromic X-linked mental retardation". RefLoc Nature Genetics 20:25-30 Feature rna; 1 Feature /aalink; 2 Feature /name: nonsense Feature /loc EMBL: ; ; 1255 Feature /codon: cga -> tga; 1 Feature /RC: -MjaIV, Feature /occurrence: 1/4 Feature aa; 2 Feature /rnalink: 1 Feature /name: premature termination Feature /loc SWISSPROT: ; 419 Feature /change: R -> * Feature /domain: TK // ID NTRK1; ; R643W; c2047t Accession K80 Date 19-Sep-1999 (Rel. 1, Created) Date 19-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Mardy S, Miura Y, Endo F, Matsuda I, Sztriha L, Frossars P, Moosa A, Ismail EAR, Macaya A, Andria C, Toscano E, Gibson W, Graham GE, Indo Y.. RefTitle "Congenital insensitivity to pain with anhidrosis: novel mutations in the TRKA (NTRK1) gene encoding a high-affinity receptor for nerve growth factor". RefLoc Am. J. Hum. Genet. 64:1570-1579 (1999). Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 2047 Feature /codon: cgg -> tgg; 1 Feature /RC: -AsuC2I, -BcnI, +BfiI, -Bme1390I, +BmrI, -Bsc4I, Feature /RC: +Bse1I, -BseLI, +BseNI, -BsiSI, -BsiYI, -BslI, Feature /RC: +BsrI, +BsrSI, -BssKI, -CauII, -HapII, -HpaII, Feature /RC: -MspI, -MspR9I, -NciI, -ScrFI, +TspRI, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 643 Feature /change: R -> W Feature /domain: TK // ID NTRK1; ; R548GRTSNVRLSCSPCCSTSTSCASSASAPRAAPCSWSSSICGTGTSTASSDPMDPMPSCWLVGRMWLQAPWVWGSCWPWLARSLRGWCTWRVCILCTGTWPHATV*; c1762 Accession K79 Date 19-Sep-1999 (Rel. 1, Created) Date 19-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Yotsumoto S, Setoyami M, Hozumi H, Mizoguchi S, Fukumaru S, Kobayashi K, Saheki T, Kanzaki T RefTitle "A novel point mutation affecting the tyrosine kinase domain of the TRKA gene in a family with congenital insensitivity to pain with anhydrosis". RefLoc The Journal of Investigative Dermatology 112(5):810-814 (1999). Feature rna; 1 Feature /aalink; 2 Feature /name: frameshift Feature /loc EMBL: ; ; 1762 Feature /codon: cgg -> -; 1 Feature /occurrence: 2/4 Feature aa; 2 Feature /rnalink: 1 Feature /name: out-of-frame extension Feature /loc SWISSPROT: ; 548 Feature /change: R -> GRTSNVRLSCSPCCSTSTSCASSASAPRAAPCSWSSSICGTGTSTASSDPMDPMPSCWLVGRMWLQAPWVWGSCWPWLARSLRGWCTWRVCILCTGTWPHATV* Feature /domain: TK // ID NTRK1; ; M581V; a1861g Accession K78 Date 19-Sep-1999 (Rel. 1, Created) Date 19-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Yotsumoto S, Setoyami M, Hozumi H, Mizoguchi S, Fukumaru S, Kobayashi K, Saheki T, Kanzaki T RefTitle "A novel point mutation affecting the tyrosine kinase domain of the TRKA gene in a family with congenital insensitivity to pain with anhydrosis". RefLoc The Journal of Investigative Dermatology 112(5):810-814 (1999). Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 1861 Feature /codon: atg -> gtg; 1 Feature /RC: -Hsp92II, -NlaIII, Feature /occurrence: 1/3 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 581 Feature /change: M -> V Feature /domain: TK // ID NTRK1; ; H598Y; c1912t Accession K82 Date 19-Sep-1999 (Rel. 1, Created) Date 19-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Mardy S, Miura Y, Endo F, Matsuda I, Sztriha L, Frossars P, Moosa A, Ismail EAR, Macaya A, Andria C, Toscano E, Gibson W, Graham GE, Indo Y.. RefTitle "Congenital insensitivity to pain with anhidrosis: novel mutations in the TRKA (NTRK1) gene encoding a high-affinity receptor for nerve growth factor". RefLoc Am. J. Hum. Genet. 64:1570-1579 (1999). Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 1912 Feature /codon: cat -> tat; 1 Feature /RC: -BsaJI, -BseDI, -Bsp19I, -BssECI, -BssT1I, -BstDSI, Feature /RC: -DsaI, -Eco130I, -EcoT14I, -ErhI, -Hsp92II, -NcoI, Feature /RC: -NlaIII, -SecI, -StyI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 598 Feature /change: H -> Y Feature /domain: TK // ID NTRK1; ; G708S; g2242a Accession K81 Date 19-Sep-1999 (Rel. 1, Created) Date 19-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Mardy S, Miura Y, Endo F, Matsuda I, Sztriha L, Frossars P, Moosa A, Ismail EAR, Macaya A, Andria C, Toscano E, Gibson W, Graham GE, Indo Y.. RefTitle "Congenital insensitivity to pain with anhidrosis: novel mutations in the TRKA (NTRK1) gene encoding a high-affinity receptor for nerve growth factor". RefLoc Am. J. Hum. Genet. 64:1570-1579 (1999). Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 2242 Feature /codon: ggc -> agc; 1 Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 708 Feature /change: G -> S Feature /domain: TK // ID NTRK1; ; G607V; g1940t Accession K83 Date 19-Sep-1999 (Rel. 1, Created) Date 19-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Mardy S, Miura Y, Endo F, Matsuda I, Sztriha L, Frossars P, Moosa A, Ismail EAR, Macaya A, Andria C, Toscano E, Gibson W, Graham GE, Indo Y.. RefTitle "Congenital insensitivity to pain with anhidrosis: novel mutations in the TRKA (NTRK1) gene encoding a high-affinity receptor for nerve growth factor". RefLoc Am. J. Hum. Genet. 64:1570-1579 (1999). Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 1940 Feature /codon: ggt -> gtt; 2 Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 607 Feature /change: G -> V Feature /domain: TK // ID NTRK1; ; G571R; g1831c Accession K39 Date 5-Mar-1998 (Rel. 1, Created) Date 5-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Indo Y, Tsuruta M, Hayashida Y, Karim MA, Ohta K, Kawano T, RefAuthors Mitsubichi H, Tonoki H, Awaya Y, Matsuda I. RefTitle "Mutations in the TRKA/NGF receptor gene in patients with RefTitle congenital insensitivity to pain with anhidrosis". RefLoc Nature genetetics 13:485-488 (1996) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 1831 Feature /codon: ggc -> cgc; 1 Feature /RC: +AccII, +AciI, -AcyI, -BbiII, -BsaHI, +Bsh1236I, Feature /RC: -BstACI, +BstUI, +FnuDII, -Hin1I, -Hsp92I, -Msp17I, Feature /RC: +MvnI, +ThaI, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 571 Feature /change: G -> R Feature /domain: TK // ID MET PROTO-ONCOGENE; MET: ; ; Y1230H; t3882c Accession K37 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Schmidt L, Duh F-M, Chen F, Kishida T, Glenn G, Choyke P, RefAuthors Scherer SW, Zhuang Z, Lubensky I, Dean M, Allikmets R, RefAuthors Chidambaram A, Bergerheim UR, Feltis JT, Casadevall C, RefAuthors Zamarron A, Bernues M, Richard S, Lips CJM, Walther MM, RefAuthors Tsui L-C, Geil L, Orcutt ML, Stackhouse T, Lipan J, Slife L, RefAuthors Brauch H, Decker J, Niehans G, Hughson MD, Moch H, Storkel S, RefAuthors Lerman MI, Linehan WM, Zbar B. RefTitle "Germline and somatic mutations in the tyrosine kinase domain RefTitle of the MET proto-oncogene in papillary renal carcinomas". RefLoc Nature genetics 16:68-73 (1997) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: X54559; g34557; 3882 Feature /codon: tat -> cat; 1 Feature /RC: -AflIII, +AvaIII, -BspLU11I, +CviRI, +EcoT22I, +Mph1103I, Feature /RC: +NsiI, +Ppu10I, +Zsp2I, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P08581; 1230 Feature /change: Y -> H Feature /domain: TK // ID MET PROTO-ONCOGENE; MET: ; ; Y1230C; a3883g Accession K34 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Schmidt L, Duh F-M, Chen F, Kishida T, Glenn G, Choyke P, RefAuthors Scherer SW, Zhuang Z, Lubensky I, Dean M, Allikmets R, RefAuthors Chidambaram A, Bergerheim UR, Feltis JT, Casadevall C, RefAuthors Zamarron A, Bernues M, Richard S, Lips CJM, Walther MM, RefAuthors Tsui L-C, Geil L, Orcutt ML, Stackhouse T, Lipan J, Slife L, RefAuthors Brauch H, Decker J, Niehans G, Hughson MD, Moch H, Storkel S, RefAuthors Lerman MI, Linehan WM, Zbar B. RefTitle "Germline and somatic mutations in the tyrosine kinase domain RefTitle of the MET proto-oncogene in papillary renal carcinomas". RefLoc Nature genetics 16:68-73 (1997) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: X54559; g34557; 3883 Feature /codon: tat -> tgt; 2 Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P08581; 1230 Feature /change: Y -> C Feature /domain: TK // ID MET PROTO-ONCOGENE; MET: ; ; V1220I; g3852a Accession K32 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Schmidt L, Duh F-M, Chen F, Kishida T, Glenn G, Choyke P, RefAuthors Scherer SW, Zhuang Z, Lubensky I, Dean M, Allikmets R, RefAuthors Chidambaram A, Bergerheim UR, Feltis JT, Casadevall C, RefAuthors Zamarron A, Bernues M, Richard S, Lips CJM, Walther MM, RefAuthors Tsui L-C, Geil L, Orcutt ML, Stackhouse T, Lipan J, Slife L, RefAuthors Brauch H, Decker J, Niehans G, Hughson MD, Moch H, Storkel S, RefAuthors Lerman MI, Linehan WM, Zbar B. RefTitle "Germline and somatic mutations in the tyrosine kinase domain RefTitle of the MET proto-oncogene in papillary renal carcinomas". RefLoc Nature genetics 16:68-73 (1997) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: X54559; g34557; 3852 Feature /codon: gtt -> att; 1 Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P08581; 1220 Feature /change: V -> I Feature /domain: TK // ID MET PROTO-ONCOGENE; MET: ; ; V1188L; g3756t Accession K31 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Schmidt L, Duh F-M, Chen F, Kishida T, Glenn G, Choyke P, RefAuthors Scherer SW, Zhuang Z, Lubensky I, Dean M, Allikmets R, RefAuthors Chidambaram A, Bergerheim UR, Feltis JT, Casadevall C, RefAuthors Zamarron A, Bernues M, Richard S, Lips CJM, Walther MM, RefAuthors Tsui L-C, Geil L, Orcutt ML, Stackhouse T, Lipan J, Slife L, RefAuthors Brauch H, Decker J, Niehans G, Hughson MD, Moch H, Storkel S, RefAuthors Lerman MI, Linehan WM, Zbar B. RefTitle "Germline and somatic mutations in the tyrosine kinase domain RefTitle of the MET proto-oncogene in papillary renal carcinomas". RefLoc Nature genetics 16:68-73 (1997) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: X54559; g34557; 3756 Feature /codon: gta -> tta; 1 Feature /RC: +Sse9I, +Tsp509I, +TspEI, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P08581; 1188 Feature /change: V -> L Feature /domain: TK // ID MET PROTO-ONCOGENE; MET: ; ; M1250T; t3943c Accession K38 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Schmidt L, Duh F-M, Chen F, Kishida T, Glenn G, Choyke P, RefAuthors Scherer SW, Zhuang Z, Lubensky I, Dean M, Allikmets R, RefAuthors Chidambaram A, Bergerheim UR, Feltis JT, Casadevall C, RefAuthors Zamarron A, Bernues M, Richard S, Lips CJM, Walther MM, RefAuthors Tsui L-C, Geil L, Orcutt ML, Stackhouse T, Lipan J, Slife L, RefAuthors Brauch H, Decker J, Niehans G, Hughson MD, Moch H, Storkel S, RefAuthors Lerman MI, Linehan WM, Zbar B. RefTitle "Germline and somatic mutations in the tyrosine kinase domain RefTitle of the MET proto-oncogene in papillary renal carcinomas". RefLoc Nature genetics 16:68-73 (1997) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: X54559; g34557; 3943 Feature /codon: atg -> acg; 2 Feature /RC: +BcefI, -BseGI, -BstF5I, -FokI, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P08581; 1250 Feature /change: M -> T Feature /domain: TK // ID MET PROTO-ONCOGENE; MET: ; ; M1131T; t3586c Accession K30 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Schmidt L, Duh F-M, Chen F, Kishida T, Glenn G, Choyke P, RefAuthors Scherer SW, Zhuang Z, Lubensky I, Dean M, Allikmets R, RefAuthors Chidambaram A, Bergerheim UR, Feltis JT, Casadevall C, RefAuthors Zamarron A, Bernues M, Richard S, Lips CJM, Walther MM, RefAuthors Tsui L-C, Geil L, Orcutt ML, Stackhouse T, Lipan J, Slife L, RefAuthors Brauch H, Decker J, Niehans G, Hughson MD, Moch H, Storkel S, RefAuthors Lerman MI, Linehan WM, Zbar B. RefTitle "Germline and somatic mutations in the tyrosine kinase domain RefTitle of the MET proto-oncogene in papillary renal carcinomas". RefLoc Nature genetics 16:68-73 (1997) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: X54559; g34557; 3586 Feature /codon: atg -> acg; 2 Feature /RC: -BspHI, -Hsp92II, -NlaIII, -RcaI, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P08581; 1131 Feature /change: M -> T Feature /domain: TK // ID MET PROTO-ONCOGENE; MET: ; ; L1195V; c3777g Accession K35 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Schmidt L, Duh F-M, Chen F, Kishida T, Glenn G, Choyke P, RefAuthors Scherer SW, Zhuang Z, Lubensky I, Dean M, Allikmets R, RefAuthors Chidambaram A, Bergerheim UR, Feltis JT, Casadevall C, RefAuthors Zamarron A, Bernues M, Richard S, Lips CJM, Walther MM, RefAuthors Tsui L-C, Geil L, Orcutt ML, Stackhouse T, Lipan J, Slife L, RefAuthors Brauch H, Decker J, Niehans G, Hughson MD, Moch H, Storkel S, RefAuthors Lerman MI, Linehan WM, Zbar B. RefTitle "Germline and somatic mutations in the tyrosine kinase domain RefTitle of the MET proto-oncogene in papillary renal carcinomas". RefLoc Nature genetics 16:68-73 (1997) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: X54559; g34557; 3777 Feature /codon: ctt -> gtt; 1 Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P08581; 1195 Feature /change: L -> V Feature /domain: TK // ID MET PROTO-ONCOGENE; MET: ; ; D1228N; g3876a Accession K33 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Schmidt L, Duh F-M, Chen F, Kishida T, Glenn G, Choyke P, RefAuthors Scherer SW, Zhuang Z, Lubensky I, Dean M, Allikmets R, RefAuthors Chidambaram A, Bergerheim UR, Feltis JT, Casadevall C, RefAuthors Zamarron A, Bernues M, Richard S, Lips CJM, Walther MM, RefAuthors Tsui L-C, Geil L, Orcutt ML, Stackhouse T, Lipan J, Slife L, RefAuthors Brauch H, Decker J, Niehans G, Hughson MD, Moch H, Storkel S, RefAuthors Lerman MI, Linehan WM, Zbar B. RefTitle "Germline and somatic mutations in the tyrosine kinase domain RefTitle of the MET proto-oncogene in papillary renal carcinomas". RefLoc Nature genetics 16:68-73 (1997) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: X54559; g34557; 3876 Feature /codon: gac -> aac; 1 Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P08581; 1228 Feature /change: D -> N Feature /domain: TK // ID MET PROTO-ONCOGENE; MET: ; ; D1228H; g3876c Accession K36 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Schmidt L, Duh F-M, Chen F, Kishida T, Glenn G, Choyke P, RefAuthors Scherer SW, Zhuang Z, Lubensky I, Dean M, Allikmets R, RefAuthors Chidambaram A, Bergerheim UR, Feltis JT, Casadevall C, RefAuthors Zamarron A, Bernues M, Richard S, Lips CJM, Walther MM, RefAuthors Tsui L-C, Geil L, Orcutt ML, Stackhouse T, Lipan J, Slife L, RefAuthors Brauch H, Decker J, Niehans G, Hughson MD, Moch H, Storkel S, RefAuthors Lerman MI, Linehan WM, Zbar B. RefTitle "Germline and somatic mutations in the tyrosine kinase domain RefTitle of the MET proto-oncogene in papillary renal carcinomas". RefLoc Nature genetics 16:68-73 (1997) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: X54559; g34557; 3876 Feature /codon: gac -> cac; 1 Feature /RC: +MslI, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P08581; 1228 Feature /change: D -> H Feature /domain: TK // ID MAST/STEM CELL GROWTH FACTOR RECEPTOR; KKIT; ; K642SPELPW*; aa1946 Accession K26 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Spritz RA, Giebel LB, Holmes SA. RefTitle "Dominant negative and loss of function mutations of the c-kit RefTitle (mast/stem cell growth factor receptor) proto-oncogene in human RefTitle piebaldism". RefLoc Am. J. Hum. Genet. 50:261-269 (1992) Feature rna; 1 Feature /aalink; 2 Feature /name: frameshift Feature /loc EMBL: X06182; g34084; 1946..1947 Feature /codon: aaa -> -; 2 Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: out-of-frame extension Feature /loc SWISSPROT: P10721; 642 Feature /change: K -> SPELPW* Feature /domain: TK // ID MAST/STEM CELL GROWTH FACTOR RECEPTOR; KKIT; ; H650P; a1970c Accession K23 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Ezoe K, Holmes SA, Ho L, Bennet CP, Bolognia JL, Brueton L, RefAuthors Burn J, Falabella R, Gatto EM, Ishii N, Moss C, Pittelkow MR, RefAuthors Thompson E, Ward KA, Spritz RA. RefTitle "Novel mutations and deletions of the KIT (steel factor RefTitle receptor) gene in human piebaldism". RefLoc Am. J. Hum. Genet. 56:58-66 (1995) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: X06182; g34084; 1970 Feature /codon: cac -> ccc; 2 Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P10721; 650 Feature /change: H -> P Feature /domain: TK // ID MAST/STEM CELL GROWTH FACTOR RECEPTOR; KKIT; ; H630QFDRTGSPHV*; t1911a Accession K27 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Ezoe K, Holmes SA, Ho L, Bennet CP, Bolognia JL, Brueton L, RefAuthors Burn J, Falabella R, Gatto EM, Ishii N, Moss C, Pittelkow MR, RefAuthors Thompson E, Ward KA, Spritz RA. RefTitle "Novel mutations and deletions of the KIT (steel factor RefTitle receptor) gene in human piebaldism". RefLoc Am. J. Hum. Genet. 56:58-66 (1995) Feature rna; 1 Feature /aalink; 2 Feature /name: frameshift Feature /loc EMBL: X06182; g34084; 1911 Feature /codon: cat -> -; 3 Feature /occurrence: 2/2 Feature aa; 2 Feature /rnalink: 1 Feature /name: out-of-frame extension Feature /loc SWISSPROT: P10721; 630 Feature /change: H -> QFDRTGSPHV* Feature /domain: TK // ID MAST/STEM CELL GROWTH FACTOR RECEPTOR; KKIT; ; H630Q; t1911a Accession K22 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Ezoe K, Holmes SA, Ho L, Bennet CP, Bolognia JL, Brueton L, RefAuthors Burn J, Falabella R, Gatto EM, Ishii N, Moss C, Pittelkow MR, RefAuthors Thompson E, Ward KA, Spritz RA. RefTitle "Novel mutations and deletions of the KIT (steel factor RefTitle receptor) gene in human piebaldism". RefLoc Am. J. Hum. Genet. 56:58-66 (1995) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: X06182; g34084; 1911 Feature /codon: cat -> caa; 3 Feature /RC: +MfeI, +MunI, +Sse9I, +Tsp509I, +TspEI, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P10721; 630 Feature /change: H -> Q Feature /domain: TK // ID MAST/STEM CELL GROWTH FACTOR RECEPTOR; KKIT; ; G664R; g2011a Accession K25 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Giebel LB, Spritz RA RefTitle "Mutation of the KIT (mast/stem cell growth factor receptor) RefTitle protooncogene in human piebaldism". RefLoc Proc. Natl. Acad. Sci. USA 88:8696-8699 (1991) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: X06182; g34084; 2011 Feature /codon: ggg -> agg; 1 Feature /RC: -ApaI, -BanII, -BmgI, -BscBI, -Bsp120I, -BspLI, Feature /RC: -DraII, -Eco24I, -EcoO109I, -EcoT38I, -FriOI, -HgiJII, Feature /RC: -NlaIV, -PspN4I, -PspOMI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P10721; 664 Feature /change: G -> R Feature /domain: TK // ID MAST/STEM CELL GROWTH FACTOR RECEPTOR; KKIT; ; E861A; a2603c Accession K24 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Ezoe K, Holmes SA, Ho L, Bennet CP, Bolognia JL, Brueton L, RefAuthors Burn J, Falabella R, Gatto EM, Ishii N, Moss C, Pittelkow MR, RefAuthors Thompson E, Ward KA, Spritz RA. RefTitle "Novel mutations and deletions of the KIT (steel factor RefTitle receptor) gene in human piebaldism". RefLoc Am. J. Hum. Genet. 56:58-66 (1995) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: X06182; g34084; 2603 Feature /codon: gag -> gcg; 2 Feature /RC: -AluI, +AspLEI, -BplI, +Bsp143II, +BstH2I, +CfoI, Feature /RC: -CviJI, +HaeII, +HhaI, +Hin6I, +HinP1I, +HspAI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P10721; 861 Feature /change: E -> A Feature /domain: TK // ID MAST/STEM CELL GROWTH FACTOR RECEPTOR; KKIT; ; D820G; a2480g Accession K28 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Pignon J-M, Giraudier S, Duquesnoy P, Jpualt H, Imbert M, RefAuthors Vainchenker W, Vernant J-P, Tulliez M. RefTitle "A new c-kit mutation in a case of agressive mast cell disease". RefLoc Br. J. haem. 96:374-376 (1997 Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: X06182; g34084; 2480 Feature /codon: gat -> ggt; 2 Feature /RC: -HinfI, -TfiI, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P10721; 820 Feature /change: D -> G Feature /domain: TK // ID MAST/STEM CELL GROWTH FACTOR RECEPTOR; KKIT; ; D816V; a2468t Accession K29 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Furitsu T, Tsujimura T, Tono T, Ikeda H, Kitayama H, RefAuthors Koshimizu U, Sugahara H, Butterfield JH, Ashman LK, Kanayama Y, RefAuthors Matsuzawa Y, Kitamura Y, Kanakura Y. RefTitle "Identification of mutations in the coding sequence of the RefTitle proto-oncogene c-kit in a human mast cell leukemia cell line RefTitle causing ligand-independent activation of c-kit product". RefLoc J. Clin. Invest. 92:1736-1744 (1933) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: X06182; g34084; 2468 Feature /codon: gac -> gtc; 2 Feature /RC: +HinfI, +PleI, Feature /occurrence: 3/6 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P10721; 816 Feature /change: D -> V Feature /domain: TK // ID MAST/STEM CELL GROWTH FACTOR RECEPTOR; KKIT; ; A621T; g1882a Accession K21 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Ezoe K, Holmes SA, Ho L, Bennet CP, Bolognia JL, Brueton L, RefAuthors Burn J, Falabella R, Gatto EM, Ishii N, Moss C, Pittelkow MR, RefAuthors Thompson E, Ward KA, Spritz RA. RefTitle "Novel mutations and deletions of the KIT (steel factor RefTitle receptor) gene in human piebaldism". RefLoc Am. J. Hum. Genet. 56:58-66 (1995) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: X06182; g34084; 1882 Feature /codon: gct -> act; 1 Feature /RC: +MaeIII, +Tsp45I, +TspRI, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P10721; 621 Feature /change: A -> T Feature /domain: TK // ID LKB1; ; Y60*; c180g Accession K75 Date 19-Sep-1999 (Rel. 1, Created) Date 19-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Hemminki A, Markie D, Tomlinson I, Avizienyte, Roth S, Loukola A RefAuthors Bignell G, Warren W, Aminoff M, Hoglund P, Jarvinen H, Kristo P RefAuthors Pelin M, Ridanpaa M, Salovaara R, Toro T, Bodmer W, Olschwang S, RefAuthors Olsen AS, Stratton MR, de la Chapelle A, Aaltonen LA. RefTitle "A serine/threonine kinase gene defective in Peutz-Jeghers syndrome" RefLoc Nature 391:184-187 (1998). Feature rna; 1 Feature /aalink; 2 Feature /name: nonsense Feature /loc EMBL: ; ; 180 Feature /codon: tac -> tag; 3 Feature /RC: -BcefI, +BstDEI, +DdeI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: premature termination Feature /loc SWISSPROT: ; 60 Feature /change: Y -> * Feature /domain: TK // ID LKB1; ; Y253*; c759a Accession K69 Date 19-Sep-1999 (Rel. 1, Created) Date 19-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Jenne DE, Reimann H, Nezu J-I, Friedel W, Loff S, Jeschke R, Muller O, Back W, Zimmer M. RefTitle "Peutz-Jeghers syndrome is caused by mutations in a novel serine threonine kinase". RefLoc Nature Genetics 18:38-43 (1998). Feature rna; 1 Feature /aalink; 2 Feature /name: nonsense Feature /loc EMBL: ; ; 759 Feature /codon: tac -> taa; 3 Feature /RC: -AfaI, -Csp6I, +MaeIII, -RsaI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: premature termination Feature /loc SWISSPROT: ; 253 Feature /change: Y -> * Feature /domain: TK // ID LKB1; ; WS239WLGSPSTTSPRVCTPSKGTTSTSCLRTSGRGATPSRATVAPRSLTC*; ggtc716 Accession K68 Date 19-Sep-1999 (Rel. 1, Created) Date 19-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Jenne DE, Reimann H, Nezu J-I, Friedel W, Loff S, Jeschke R, Muller O, Back W, Zimmer M. RefTitle "Peutz-Jeghers syndrome is caused by mutations in a novel serine threonine kinase". RefLoc Nature Genetics 18:38-43 (1998). Feature rna; 1 Feature /aalink; 2 Feature /name: frameshift Feature /loc EMBL: ; ; 716..719 Feature /codon: tgg -> -; 2 Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: out-of-frame extension Feature /loc SWISSPROT: ; 239..240 Feature /change: WS -> WLGSPSTTSPRVCTPSKGTTSTSCLRTSGRGATPSRATVAPRSLTC* Feature /domain: TK // ID LKB1; ; Q170*; c508t Accession K67 Date 19-Sep-1999 (Rel. 1, Created) Date 19-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Guldberg P, Straten PT, Ahrenkiel V, Seremet T, Kirkin A, Zeuthen J. RefTitle Somatic mutation of the Peutz-Jeghers syndrome gene, LKB1/STK11, in malignant melanoma. RefLoc Cell Oncogene 18:1777-1780 (1999). Feature rna; 1 Feature /aalink; 2 Feature /name: nonsense Feature /loc EMBL: ; ; 508 Feature /codon: cag -> tag; 1 Feature /RC: +AluI, +BfaI, -Bme1390I, -BsaJI, -BseDI, -BsiLI, Feature /RC: -BssECI, -BssKI, -BstNI, -BstOI, -Bst2UI, -EcoRII, Feature /RC: +MaeI, -MspR9I, -MvaI, -PspGI, -ScrFI, -SecI, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: premature termination Feature /loc SWISSPROT: ; 170 Feature /change: Q -> * Feature /domain: TK // ID LKB1; ; P281PSLTC*; g843 Accession K70 Date 19-Sep-1999 (Rel. 1, Created) Date 19-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Jenne DE, Reimann H, Nezu J-I, Friedel W, Loff S, Jeschke R, Muller O, Back W, Zimmer M. RefTitle "Peutz-Jeghers syndrome is caused by mutations in a novel serine threonine kinase". RefLoc Nature Genetics 18:38-43 (1998). Feature rna; 1 Feature /aalink; 2 Feature /name: frameshift Feature /loc EMBL: ; ; 843 Feature /codon: ccg -> -; 3 Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: out-of-frame extension Feature /loc SWISSPROT: ; 281 Feature /change: P -> PSLTC* Feature /domain: TK // ID LKB1; ; L67P; t200c Accession K74 Date 19-Sep-1999 (Rel. 1, Created) Date 19-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Hemminki A, Markie D, Tomlinson I, Avizienyte, Roth S, Loukola A RefAuthors Bignell G, Warren W, Aminoff M, Hoglund P, Jarvinen H, Kristo P RefAuthors Pelin M, Ridanpaa M, Salovaara R, Toro T, Bodmer W, Olschwang S, RefAuthors Olsen AS, Stratton MR, de la Chapelle A, Aaltonen LA. RefTitle "A serine/threonine kinase gene defective in Peutz-Jeghers syndrome" RefLoc Nature 391:184-187 (1998). Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 200 Feature /codon: ctg -> ccg; 2 Feature /RC: +AccB1I, +BanI, +BscBI, +BshNI, +BsiSI, -BspGI, Feature /RC: +BspLI, +Eco64I, +HapII, +HgiCI, +HpaII, +MspI, Feature /RC: +NlaIV, +PspN4I, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 67 Feature /change: L -> P Feature /domain: TK // ID LKB1; ; K84*; a250t Accession K76 Date 19-Sep-1999 (Rel. 1, Created) Date 19-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Hemminki A, Markie D, Tomlinson I, Avizienyte, Roth S, Loukola A RefAuthors Bignell G, Warren W, Aminoff M, Hoglund P, Jarvinen H, Kristo P RefAuthors Pelin M, Ridanpaa M, Salovaara R, Toro T, Bodmer W, Olschwang S, RefAuthors Olsen AS, Stratton MR, de la Chapelle A, Aaltonen LA. RefTitle "A serine/threonine kinase gene defective in Peutz-Jeghers syndrome" RefLoc Nature 391:184-187 (1998). Feature rna; 1 Feature /aalink; 2 Feature /name: nonsense Feature /loc EMBL: ; ; 250 Feature /codon: aag -> tag; 1 Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: premature termination Feature /loc SWISSPROT: ; 84 Feature /change: K -> * Feature /domain: TK // ID LKB1; ; IRQH303N; tccggcagc908 Accession K77 Date 19-Sep-1999 (Rel. 1, Created) Date 19-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Hemminki A, Markie D, Tomlinson I, Avizienyte, Roth S, Loukola A RefAuthors Bignell G, Warren W, Aminoff M, Hoglund P, Jarvinen H, Kristo P RefAuthors Pelin M, Ridanpaa M, Salovaara R, Toro T, Bodmer W, Olschwang S, RefAuthors Olsen AS, Stratton MR, de la Chapelle A, Aaltonen LA. RefTitle "A serine/threonine kinase gene defective in Peutz-Jeghers syndrome" RefLoc Nature 391:184-187 (1998). Feature rna; 1 Feature /aalink; 2 Feature /name: inframe Feature /loc EMBL: ; ; 908..916 Feature /codon: atc -> -; 2 Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: deletion Feature /loc SWISSPROT: ; 303..306 Feature /change: IRQH -> N Feature /domain: TK // ID LKB1; ; G163D; g488a Accession K64 Date 22-Aug-1999 (Rel. 1, Created) Date 22-Aug-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Avizienyte E., Roth S., Loukola A., Hemminki A., Lothe R. A., Stenwig A.E., Fossa S.D., Salovaara R., Aaltonen L.A. RefTitle "Somatic Mutations in LKB1 are rare in sporadic colorectal and testicular tumors" RefLoc Cance Research 58:2087-2090 (1998) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 488 Feature /codon: ggc -> gac; 2 Feature /RC: -BcefI, -BshI, -BsuRI, -CviJI, -CviTI, -HaeIII, Feature /RC: -PalI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 163 Feature /change: G -> D Feature /domain: TK // ID LKB1; ; E70*; g208t Accession K73 Date 19-Sep-1999 (Rel. 1, Created) Date 19-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Hemminki A, Markie D, Tomlinson I, Avizienyte, Roth S, Loukola A RefAuthors Bignell G, Warren W, Aminoff M, Hoglund P, Jarvinen H, Kristo P RefAuthors Pelin M, Ridanpaa M, Salovaara R, Toro T, Bodmer W, Olschwang S, RefAuthors Olsen AS, Stratton MR, de la Chapelle A, Aaltonen LA. RefTitle "A serine/threonine kinase gene defective in Peutz-Jeghers syndrome" RefLoc Nature 391:184-187 (1998). Feature rna; 1 Feature /aalink; 2 Feature /name: nonsense Feature /loc EMBL: ; ; 208 Feature /codon: gag -> tag; 1 Feature /RC: +AccI, +FblI, -Hpy188IX, +MjaIV, +Pfl1108I, +XmiI, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: premature termination Feature /loc SWISSPROT: ; 70 Feature /change: E -> * Feature /domain: TK // ID LKB1; ; E57*; g169t Accession K72 Date 19-Sep-1999 (Rel. 1, Created) Date 19-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Hemminki A, Markie D, Tomlinson I, Avizienyte, Roth S, Loukola A RefAuthors Bignell G, Warren W, Aminoff M, Hoglund P, Jarvinen H, Kristo P RefAuthors Pelin M, Ridanpaa M, Salovaara R, Toro T, Bodmer W, Olschwang S, RefAuthors Olsen AS, Stratton MR, de la Chapelle A, Aaltonen LA. RefTitle "A serine/threonine kinase gene defective in Peutz-Jeghers syndrome" RefLoc Nature 391:184-187 (1998). Feature rna; 1 Feature /aalink; 2 Feature /name: nonsense Feature /loc EMBL: ; ; 169 Feature /codon: gaa -> taa; 1 Feature /RC: -Bsc4I, -BseLI, -BsiYI, -BslI, +HgiEII, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: premature termination Feature /loc SWISSPROT: ; 57 Feature /change: E -> * Feature /domain: TK // ID LKB1; ; D194Y; g580t Accession K71 Date 19-Sep-1999 (Rel. 1, Created) Date 19-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Guldberg P, Straten PT, Ahrenkiel V, Seremet T, Kirkin A, Zeuthen J. RefTitle Somatic mutation of the Peutz-Jeghers syndrome gene, LKB1/STK11, in malignant melanoma. RefLoc Cell Oncogene 18:1777-1780 (1999). Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 580 Feature /codon: gac -> tac; 1 Feature /RC: -Hpy188IX, -MmeI, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 194 Feature /change: D -> Y Feature /domain: TK // ID KIR3; ; R411Q; g1514a Accession K59 Date 22-Aug-1999 (Rel. 1, Created) Date 22-Aug-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Johnson D.W., Berg J.N., Baldwin M.A., Gallione C.J., Marondel U., Yoon S-J., Stenzel T.R., Speer M., Pericak-Vance M.A., Diamond A., Guttmacher A.E., Jackson C.E., Attisano L., Kucherlapati R., Porteous M.E.M., Marchuk D.A. RefTitle "Mutations in the activin receptor-like minase 1 gene in Hereditary hemorrhagic telangiectasia type 2." RefLoc Nature genetics 13:189-195, 1996 Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 1514 Feature /codon: cgg -> cag; 2 Feature /RC: -AspS9I, -AsuI, -AvaII, -Bme18I, -BsiSI, -BsiZI, Feature /RC: -Cfr13I, -Eco47I, -HapII, -HgiEI, -HpaII, -MspI, Feature /RC: -Sau96I, -SinI, Feature /occurrence: 1/9 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 411 Feature /change: R -> Q Feature /domain: TK // ID KIR3; ; R374W; c1402t Accession K56 Date 22-Aug-1999 (Rel. 1, Created) Date 22-Aug-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Berg J.N, Gallione C.J., Stenzel T.T., Johnson D.W., Allen W.P.,Schwartz C.E., Jackson C.E., Porteous M.E.M., Mrchuk D.A. RefTitle "The Activin Receptor-Like Kinase 1 gene: Genomic Structure and Mutations in Hereditary Hemorrhagic Telangiectasia Type 2." RefLoc Am. J. Hum. Genet. 61:60-67, 1997 Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 1402 Feature /codon: cgg -> tgg; 1 Feature /RC: +AdeI, +DraIII, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 374 Feature /change: R -> W Feature /domain: TK // ID KIR3; ; P424T; c1552a Accession K57 Date 22-Aug-1999 (Rel. 1, Created) Date 22-Aug-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Berg J.N, Gallione C.J., Stenzel T.T., Johnson D.W., Allen W.P.,Schwartz C.E., Jackson C.E., Porteous M.E.M., Mrchuk D.A. RefTitle "The Activin Receptor-Like Kinase 1 gene: Genomic Structure and Mutations in Hereditary Hemorrhagic Telangiectasia Type 2." RefLoc Am. J. Hum. Genet. 61:60-67, 1997 Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 1552 Feature /codon: ccc -> acc; 1 Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 424 Feature /change: P -> T Feature /domain: TK // ID KIR3; ; M376R; t1409g Accession K58 Date 22-Aug-1999 (Rel. 1, Created) Date 22-Aug-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Johnson D.W., Berg J.N., Baldwin M.A., Gallione C.J., Marondel U., Yoon S-J., Stenzel T.R., Speer M., Pericak-Vance M.A., Diamond A., Guttmacher A.E., Jackson C.E., Attisano L., Kucherlapati R., Porteous M.E.M., Marchuk D.A. RefTitle "Mutations in the activin receptor-like minase 1 gene in Hereditary hemorrhagic telangiectasia type 2." RefLoc Nature genetics 13:189-195, 1996 Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 1409 Feature /codon: atg -> agg; 2 Feature /RC: +BseSI, -Hsp92II, -NlaIII, -XcmI, Feature /occurrence: 1/7 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 376 Feature /change: M -> R Feature /domain: TK // ID JANUS KINASE 3; JAK3; ; KKLQFYEDRQQLPAPKWTELALLIQQCMAYEPVQRPSFRAVIRDLNSLISS733KTMSSSQTPHLVPWHLVMGCGMVPSSMPAKTPRSSRRDTSSTSHSWARATLAAWSCAAMTRQPTIQVPWWP*; gaaactccaattttatgaggaccggcagcagctgccggcccccaagtggacagagctggccctgctgattcaacagtgcatggcctatgagccggtccagaggccctccttccgagccgtcattcgtgacctcaatagcctcatctcttca2294 Accession K55 Date 6-Mar-1998 (Rel. 1, Created) Date 6-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Macchi P, Villa A, Giliani S, Sacco MG, Frattini A, Porta F, RefAuthors Ugazio AG, Johnston JA, Candotti F, O'Shea JJ, Vezzoni P, RefAuthors Notarangelo LD. RefTitle "Mutations of JAK-3 gene in patients with autosomal severe RefTitle combined immune deficiency (SCID)". RefLoc Nature 377:65-68 Feature rna; 1 Feature /aalink; 2 Feature /name: frameshift Feature /loc EMBL: U09607; g508730; 2294..2444 Feature /codon: aag -> -; 3 Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: out-of-frame extension Feature /loc SWISSPROT: P52333; 733..783 Feature /change: KKLQFYEDRQQLPAPKWTELALLIQQCMAYEPVQRPSFRAVIRDLNSLISS -> KTMSSSQTPHLVPWHLVMGCGMVPSSMPAKTPRSSRRDTSSTSHSWARATLAAWSCAAMTRQPTIQVPWWP* Feature /domain: TK 1 // ID JANUS KINASE 3; JAK3; ; C759R; t2370c Accession K20 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Candotti F, Oakes SA, Johnston JA, Giliani S, Schumacher RF, RefAuthors Mella P, Fiorini M, Ugazio AG, Badolato R, Notarangelo L, RefAuthors Bozzi F, Macchi P, Strina D, Vezzoni P, Blaese RM, O'Shea JJ, RefAuthors Villa A. RefTitle "Structural and functional basis for JAK3-deficient severe RefTitle combined immunodeficiency". RefLoc Blood 90(10):3996-4003) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: U09607; g508730; 2370 Feature /codon: tgc -> cgc; 1 Feature /RC: +AspLEI, -Bst4CI, +CfoI, -CviRI, +HhaI, +Hin6I, Feature /RC: +HinP1I, +HspAI, -Tsp4CI, -TspRI, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P52333; 759 Feature /change: C -> R Feature /domain: TK 1 // ID JANUS KINASE 3; JAK3; ; C565*; c1790a Accession K19 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Russel SM, Tayebi N, Nakajima H, Riedy MC, Roberts JL, Aman MJ, RefAuthors Migone T-S, Noguchi M, Markert ML, Buckley RH, O'Shea JJ, RefAuthors Leonard WJ. RefTitle "Mutation of JAK3 in a patient with SCID: Essential role of RefTitle JAK3 in lymphoid development". RefLoc Scence 270:797-800 Feature rna; 1 Feature /aalink; 2 Feature /name: nonsense Feature /loc EMBL: U09607; g508730; 1790 Feature /codon: tgc -> tga; 3 Feature /RC: -CviRI, -Hsp92II, -NlaIII, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: premature termination Feature /loc SWISSPROT: P52333; 565 Feature /change: C -> * Feature /domain: TK 1 // ID INSULIN RECEPTOR; IRK; ; W1227S; g3818c Accession K17 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Moller DE, Flier JS. RefTitle "Detection of an alteration in the insulin-receptor gene in a RefTitle patient with insulin recistance, acanthosis nigricans, and the RefTitle polycystic ovary syndrome (type A insulin resistance). RefLoc N. Engl. J. Med. 319(23):1526-1529 Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: M10051; g186439; 3818 Feature /codon: tgg -> tcg; 2 Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P06213; 1227 Feature /change: W -> S Feature /domain: TK // ID INSULIN RECEPTOR; IRK; ; W1220L; g3797t Accession K16 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Imamura T, Takata Y, Sasaoka T, Takada Y, Morioka H, Haruta T, RefAuthors Sawa T, Iwanishi M, Hu YG, Suzuki Y, Hamada J, Kobayashi M. RefTitle "Two naturally occuring mutations in the kinase domain of RefTitle insulin receptor accelerate degradation of the insulin receptor RefTitle and impair the kinase assay". RefLoc J. Biol. Chem 269(49):31019-31027) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: M10051; g186439; 3797 Feature /codon: tgg -> ttg; 2 Feature /RC: -AspS9I, -AsuI, -AvaII, -Bme18I, -BsiZI, -Cfr13I, Feature /RC: -Eco47I, -HgiEI, -Sau96I, -SinI, Feature /occurrence: 2/5 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P06213; 1220 Feature /change: W -> L Feature /domain: TK // ID INSULIN RECEPTOR; IRK; ; R1201Q; g3740a Accession K13 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Moritz W, Froesh ER, Boni-Schnetzler M. RefTitle "Functional properties of a heterozygous mutation RefTitle (arg 1174 -> gln) in the tyrosine kinase domain of the insulin RefTitle receptor from a typa A insulin resistant patient". RefLoc FEBS Letters 351:276-280 (1994) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: M10051; g186439; 3740 Feature /codon: cgg -> cag; 2 Feature /RC: +AauI, +Bsp1407I, +BsrGI, +SspBI, +TatI, +TspRI, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P06213; 1201 Feature /change: R -> Q Feature /domain: TK // ID INSULIN RECEPTOR; IRK; ; R1191Q; g3710a Accession K12 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Cocozza S, Porcellini A, Riccardi G, Monticelli A, Condorelli G RefAuthors Ferrara A, Pianese L, Miele C, Capaldo B, Beguinot F, Varrone S. RefTitle "NIDDM associated with mutation in tyrosine kinase domain of RefTitle insulin receptor gene". RefLoc Diabetes 41:521-526 Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: M10051; g186439; 3710 Feature /codon: cgg -> cag; 2 Feature /RC: -BetI, -BsaWI, -BsiSI, -HapII, -Hin2I, -HpaII, Feature /RC: -MspI, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P06213; 1191 Feature /change: R -> Q Feature /domain: TK // ID INSULIN RECEPTOR; IRK; ; R1158Q; g3611a Accession K8 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Kishimoto M, Hashiramoto M, Yonezawa K, Shii K, Kazumi T, RefAuthors Kasuga M. RefTitle "Substitution of glutamine for arginine 1131". RefLoc J Biol. Chem. 269(15):11349-11355 (1994) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: M10051; g186439; 3611 Feature /codon: cgg -> cag; 2 Feature /RC: +AlwNI, -BscBI, -BsmFI, -BspLI, -FinI, -NlaIV, Feature /RC: -PspN4I, +Sse8647I, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P06213; 1158 Feature /change: R -> Q Feature /domain: TK // ID INSULIN RECEPTOR; IRK; ; P1205L; c3752t Accession K14 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Kim H, Kadowaki H, Sakura H, Odawara M, Komomura K, Takahashi Y, RefAuthors Miyazaki Y, Ohtani T, Akanuma Y, Yazaki Y, Kasuga M, Taylor SI, RefAuthors Kadowaki T. RefTitle "Detection of mutations in the insulin receptor gene in RefTitle patients with insulin resistance by analysis of single-stranded RefTitle conformational polymorphisms". RefLoc Diabetologia 35:261-266 (1992) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: M10051; g186439; 3752 Feature /codon: ccg -> ctg; 2 Feature /RC: -AccB1I, -BanI, -BetI, +BpmI, -BsaWI, -BscBI, Feature /RC: +Bse1I, +BseNI, -BshNI, -BsiSI, -BspLI, +BsrI, Feature /RC: +BsrSI, -Eco64I, +GsuI, -HapII, -HgiCI, -Hin2I, Feature /RC: -HpaII, -MspI, -NlaIV, -PspN4I, +TspRI, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P06213; 1205 Feature /change: P -> L Feature /domain: TK // ID INSULIN RECEPTOR; IRK; ; M1180I; g3678a Accession K11 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Cama A, Sierra MdlL, Ottini L, Kadowaki T, Gorden P, RefAuthors Imperato-McGinley J, Taylor SI. RefTitle "A mutation in the tyrosine kinase domain of the insulin RefTitle receptor associated with insulin resistance in an obese woman". RefLoc J. Clin. Endocr. & Metabol. 73(4):894-901 (1991) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: M10051; g186439; 3678 Feature /codon: atg -> ata; 3 Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P06213; 1180 Feature /change: M -> I Feature /domain: TK // ID INSULIN RECEPTOR; IRK; ; M1136IFRWRQRLLTGWPT*; g3546 Accession K18 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Kadowaki H, Takakashi Y, Ando A, Momomura K, Kaburagi Y, RefAuthors Quin JD, MacCuish AC, Koda N, Fukushima Y, Taylor SI, Akanuma Y, RefAuthors Yazaki Y, Kadowaki T. RefTitle "Four mutant alleles of the insulin receptor gene associated RefTitle with genetic syndromes of extreme insulin resistance". RefLoc Biochem Biophys Res Commun 237:516-520 (1997) RefNote RefNote NOTE!!: Article termination at +10, here calculated +13!!!! Feature rna; 1 Feature /aalink; 2 Feature /name: frameshift Feature /loc EMBL: M10051; g186439; 3546 Feature /codon: atg -> -; 3 Feature /occurrence: 2/2 Feature aa; 2 Feature /rnalink: 1 Feature /name: out-of-frame extension Feature /loc SWISSPROT: P06213; 1136 Feature /change: M -> IFRWRQRLLTGWPT* Feature /domain: TK // ID INSULIN RECEPTOR; IRK; ; K1095E; a3421g Accession K7 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors O'Rahilly S, Choi WH, Patel P, Turner RC, Flier JS, Moller DE. RefTitle "Detection of mutations in insulin-receptor gene in NIDDM RefTitle patients by analysis of single-stranded conformation RefTitle polymorphisms". RefLoc Diabetes 40:777-782 (1991) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: M10051; g186439; 3421 Feature /codon: aag -> gag; 1 Feature /RC: -BssT1I, -Eco130I, -EcoT14I, -ErhI, -StyI, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P06213; 1095 Feature /change: K -> E Feature /domain: TK // ID INSULIN RECEPTOR; IRK; ; E1206D; g3756c Accession K15 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Imamura T, Takata Y, Sasaoka T, Takada Y, Morioka H, Haruta T, RefAuthors Sawa T, Iwanishi M, Hu YG, Suzuki Y, Hamada J, Kobayashi M. RefTitle "Two naturally occuring mutations in the kinase domain of RefTitle insulin receptor accelerate degradation of the insulin receptor RefTitle and impair the kinase assay". RefLoc J. Biol. Chem 269(49):31019-31027) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: M10051; g186439; 3756 Feature /codon: gag -> gac; 3 Feature /RC: -PleI, Feature /occurrence: 1/2 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P06213; 1206 Feature /change: E -> D Feature /domain: TK // ID INSULIN RECEPTOR; IRK; ; A1162E; c3623a Accession K10 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Cama A, Sierra MdlL, Quon MJ, Ottini L, Gorden P, Taylor SI. RefTitle "Substitution of glutamic acid for alanine 1135 in the putative RefTitle "catalytic loop" of the tyrosine kinase domain of the human RefTitle insulin receptor". RefLoc J. Biol. Chem. 268(11):8060-8069 (1993) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: M10051; g186439; 3623 Feature /codon: gcg -> gag; 2 Feature /RC: -BbvI, -Bst71I, -Fnu4HI, -Fsp4HI, -ItaI, -TseI, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P06213; 1162 Feature /change: A -> E Feature /domain: TK // ID INSULIN RECEPTOR; IRK; ; A1161T; g3619a Accession K9 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Moller DE, Yokota A, White MF, Pazianos AG, Flier JS. RefTitle A naturally occuring mutation of insulin receptor alanine 1134 RefTitle impairs tyrosine kinase function and is associated with RefTitle dominantly inherited insulin resistance". RefLoc J. Biol. Chem 265(25):14979-14985 (1990) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: M10051; g186439; 3619 Feature /codon: gca -> aca; 1 Feature /RC: -BbvI, -BsiLI, -BssKI, -Bst71I, -BstNI, -BstOI, Feature /RC: -Bst2UI, -EcoRII, -Fnu4HI, -Fsp4HI, -ItaI, -MspR9I, Feature /RC: -MvaI, -ScrFI, -TseI, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P06213; 1161 Feature /change: A -> T Feature /domain: TK // ID INSULIN RECEPTOR; IRK; ; A1075D; c3362a Accession K6 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Haruta T, Takata Y, Iwanishi M, Maegawa H, Imamura T, Egawa K, RefAuthors Itatzu T, Kobayashi M. RefTitle "Ala 1048 ->Asp mutation in the kinase domain of insulin receptor RefTitle causes defective kinase activity and insulin resistance". RefLoc Biabetes 42:1837-1844 (1993) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: M10051; g186439; 3362 Feature /codon: gcc -> gac; 2 Feature /RC: -AatI, +AspI, -BsaJI, -BseDI, -BshI, -BsuRI, Feature /RC: -CviJI, -Eco147I, -HaeI, -HaeIII, +HinfI, -PalI, Feature /RC: +PflFI, -Pme55I, -SecI, -SseBI, -StuI, +Tth111I, Feature /occurrence: Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P06213; 1075 Feature /change: A -> D Feature /domain: TK // ID FIBROBLAST GROWTH FACTOR RECEPTOR-3; FGFR3;; ; N540T; a1658c Accession K1 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Deutz-Terlouw PP, Losekoot M, Aalfs CM, Hennekam RCM, Bakker E. RefTitle "Asn540Thr substitution in the fibroblast growth factor receptor RefTitle 3 tyrosine kinase domain causing hypochondroplasia". RefLoc Human mutation RefNumber 2 RefLoc 37 (1997). Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: M58051; g182568; 1658 Feature /codon: aac -> acc; 2 Feature /RC: -BspMI, Feature /occurrence: 1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P22607; 540 Feature /change: N -> T Feature /domain: TK // ID FIBROBLAST GROWTH FACTOR RECEPTOR-3; FGFR3;; ; N540K; c1659g Accession K3 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Prinos P, Costa T, Sommer A, Kilpatrick MW, Tsipouras P. RefTitle "A common FGFR3 gene mutation in hypochondroplasia". RefLoc Hum. Mol. Gen. 4(11):2097-2101 (1995) RefNumber 2 RefAuthors Rousseau F, Bonaventure J, Legeai-Mallet L, Schmidt H, RefAuthors Weissenbach J, Munnich A, Le Merrer M RefTitle "Clinical and genetic heterogeneity of hypochondroplasia". RefLoc J. Med. Genet. 33:749-752 (1996) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: M58051; g182568; 1659 Feature /codon: aac -> aag; 3 Feature /RC: +AluI, -BspMI, +CviJI, +Fnu4HI, +Fsp4HI, +ItaI, Feature /RC: +TseI, Feature /occurrence: 2/2 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P22607; 540 Feature /change: N -> K Feature /domain: TK // ID FIBROBLAST GROWTH FACTOR RECEPTOR-3; FGFR3;; ; N540K; c1659a Accession K2 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Bellus GA, Mcintosh I, Smith EA, Aylsworth AS, Kaitila I, RefAuthors Horton WA, Greenhaw GA, Hecht JT, Francomano CA. RefTitle "A recurrent mutation in the tyrosine kinase domain of RefTitle fibroblast growth factor receptor 3 causes hypochondroplasia". RefLoc Nature Genetics 10:357-359 (1995) RefNumber 2 RefAuthors Rousseau F, Bonaventure J, Legeai-Mallet L, Schmidt H, RefAuthors Weissenbach J, Munnich A, Le Merrer M RefTitle "Clinical and genetic heterogeneity of hypochondroplasia". RefLoc J. Med. Genet. 33:749-752 (1996) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: M58051; g182568; 1659 Feature /codon: aac -> aaa; 3 Feature /RC: -BspMI, Feature /occurrence: 19/19 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P22607; 540 Feature /change: N -> K Feature /domain: TK // ID FIBROBLAST GROWTH FACTOR RECEPTOR-3; FGFR3;; ; K650M; a1988t Accession K5 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Francomano CA, Bellus GA, Szabo J, Mcintosh I, Dorst J, Lee R, RefAuthors Hurko O, Fraley AE, Bamshad MJ. RefTitle "A new sceletal dysplasia with severe tibial bowing, profound RefTitle developmental delay and acanthosis nigricans is caused by a RefTitle lys 650 met mutation in fibroblast growth factor receptor 3 RefTitle (FGFR3)". RefLoc Am. J. Hum. Genet. 59(suppl) A25 (1996) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: M58051; g182568; 1988 Feature /codon: aag -> atg; 2 Feature /RC: -BbsI, -BbvII, -BpiI, -BpuAI, -MboII, Feature /occurrence: 2/2 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P22607; 650 Feature /change: K -> M Feature /domain: TK // ID FIBROBLAST GROWTH FACTOR RECEPTOR-3; FGFR3;; ; K650E; a1987g Accession K4 Date 2-Mar-1998 (Rel. 1, Created) Date 2-Mar-1998 (Rel. 1, Last updated, Version 1) RefNumber 1 MEDLINE; 95291326 . RefAuthors Tavormina PL, Shiang R, Thompson LM, Zhu Y-Z, Wilkin DJ, Lachman RS, RefAuthors Wilcox WR, Rimoin DL, Cohn DH, Wasmuth JJ. RefTitle "Thanatophoric dysplasia (types I and II) caused by distinct RefTitle mutations in fibroblast growth factor receptor 3". RefLoc Nature genetics 9:321-328 (1995) Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: M58051; g182568; 1987 Feature /codon: aag -> gag; 1 Feature /RC: -BbsI, -BbvII, -BpiI, -BpuAI, -MboII, Feature /occurrence: 16/16 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P22607; 650 Feature /change: K -> E Feature /domain: TK // ID FIBROBLAST GROWTH FACTOR RECEPTOR-3; FGFR3;; ; I538V; a1651g Accession K84 Date 19-Sep-1999 (Rel. 1, Created) Date 19-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Hagenas L, Eklof O, Neumeyer L, Haerid PE, Anvret M RefTitle "A novel missense mutation ile538val in the fibroblast growth factor receptor 3 in hypochondroplasia". RefLoc Human Mutation, Mutation in brief #122 (1997) Online Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: M58051; g182568; 1651 Feature /codon: atc -> gtc; 1 Feature /RC: +MaeII, +TaiI, +TscI, Feature /occurrence: 1/3 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: P22607; 538 Feature /change: I -> V Feature /domain: TK // ID CDK4; ; R24H; g298a Accession K86 Date 20-Sep-1999 (Rel. 1, Created) Date 20-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Soufir N, Avril M-F, Chompret A, Demenais F, Bombled J, Spatz A, Stoppa-Lyonnet D, The French Familial Melanoma Study Group, Benard J, Bresssac-de Paillerets B. RefTitle "Prevalence of p16 and CDK4 germline mutations in 48 melanoma-prone families in France". RefLoc Human Molecular Genetics 7(2):209-216 (1998). Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 298 Feature /codon: cgt -> cat; 2 Feature /RC: -BscGI, +Hsp92II, +NlaIII, -Sth132I, Feature /occurrence: 1/4 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 24 Feature /change: R -> H Feature /domain: TK // ID CDK4; ; R24C; c297t Accession K60 Date 22-Aug-1999 (Rel. 1, Created) Date 22-Aug-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Zuo L., Weger J., Yang Q., Goldstein A.M., Tucker M.A., Walker G.J., Hayward N., Dracopoli N.C. RefTitle "Germline mutations in the P16-ink4a binding domain of CDK4 in familial melanoma." RefLoc Nature Genetics 12:97-99 (1996). Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 297 Feature /codon: cgt -> tgt; 1 Feature /RC: +AatI, -AspS9I, -AsuI, -BscGI, -BsiZI, -Cfr13I, Feature /RC: +Eco147I, +HaeI, +Pme55I, -Sau96I, +SseBI, -Sth132I, Feature /RC: +StuI, Feature /occurrence: 11/11 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 24 Feature /change: R -> C Feature /domain: TK // ID CDK4; ; N41S; a349g Accession K85 Date 20-Sep-1999 (Rel. 1, Created) Date 20-Sep-1999 (Rel. 1, Last updated, Version 1) RefNumber 1 RefAuthors Guldberg P, Kirkin AF, Gronbak K, Straten PT, Ahrenkiel V, Zeuthen J. RefTitle "Complete scanning of the CDK4 gene by denaturing gradient gel RefTitle electroforesis: a novel missense mutation but low overall frequency of mutations in sporadic metastatic malignant melanoma". RefLoc International Journal of Cancer 72:780-783 (1997). Feature rna; 1 Feature /aalink; 2 Feature /name: missense Feature /loc EMBL: ; ; 349 Feature /codon: aat -> agt; 2 Feature /RC: +TspRI, Feature /occurrence: 1/1 Feature aa; 2 Feature /rnalink: 1 Feature /name: substitution Feature /loc SWISSPROT: ; 41 Feature /change: N -> S Feature /domain: TK // Kinaasi mutaatioita : 227 Erilaisia : 195 ID BTK_HUMAN; ;@S378X403; AQISSVSTKQECTFHCRPGIRIMGNX Occurrence 1/1 Accession K69 DBCrossRef BTKbase:A0166 Original code F(III-1) Description frameshift insertion in the exon 13 leading to Description stop codon in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95353280 RefAuthors Hagemann, T. L., Rosen, F. S., Kwan, S. P. RefTitle Characterization of germline mutations of the gene RefTitle encoding Bruton's tyrosine kinase in families with X-linked RefTitle agammaglobulinemia RefLoc Hum. Mutat. 5(4):296-302(1995) Feature dna; 1 Feature /rnalink: 2 Feature /name: insertion Feature /loc: EMBL: Hsu78027: 63921 Feature /change: dublication of preceding 16 bp Feature /genomic_region: exon; 13 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: frameshift Feature /loc:EMBL: X58957; G312467; HSATK: 1264 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 378..403 Feature /change: SQQNKNAPST AGLGYGSWEI DPKDLT -> Feature /change: AQISSVSTKQ ECTFHCRPGI RIMGNX Feature /domain: TK Protein struct premature stop Symptoms classical XLA Sex XY Family history inherited IgA nd IgE nd IgG < 10% IgM nd B cells surf Ig nd // ID BTK_HUMAN; ;Q379X; QX Occurrence 1/1 Accession K70 DBCrossRef BTKbase:A0334 Original code DM Description nonsense mutation in the exon 13 leading to Description stop codon in SH2 domain Date 27-Aug-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (27-Aug-1996) to the BTKbase. RefLoc Dr. Michael Weiss, prof. Dr. Bernd H. Belohradsky, RefLoc Abteilung fur Infektionsimmunologia, Dr. von Haunersches RefLoc Kinderspital Klinikum Innenstadt der Universitat, Munchen, RefLoc Lindwurmstrasse 4, D-80337 Munchen, Germany, RefLoc FAX 498 951 604 928. RefLoc Dr. Elke Holinski-Feder, Dr. Alfons Meindl, Abteilung fur RefLoc Padiatrische Genetik Kinderpoliklinik, Klinikum Innenstadt RefLoc der Universitat, Munchen, Goethestrasse 29, D-80336 RefLoc Munchen, Germany. RefNumber [2] RefCrossRef MEDLINE; 98118357 RefAuthors Holinski-Feder, E., Weiss M., Brandau, O., Jedele, K. B., RefAuthors Nore, B., Beckesj", C.-M., Vihinen, M., G"tz, G., Hubbard, RefAuthors S. R., Belohradsky, B. H., Smith, C. I. E., Meindl, A. RefTitle Mutation screening of the btk gene in 56 families with RefTitle X-linked agammaglobulinemia (XLA) - 47 unique mutations RefTitle without correlation to clinical course RefLoc Pediatrics 101:276-284(1998) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 63924 Feature /change: c -> t Feature /genomic_region: exon; 13 Feature /RE: +MseI, +Tru1I, +Tru9I, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1267 Feature /codon: caa -> taa; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 379 Feature /change: Q -> X Feature /domain: TK Symptoms classical XLA Sex XY Age 1.5 IgA < 0.07 IgG 0.61 IgM 0.17 CD19 1 Comment -!-Symptoms: recurrent urinary tract infections, Comment hemorrhagic cystitis // ID BTK_HUMAN; ;G391G; GG Occurrence 1/1 Accession K71 DBCrossRef BTKbase:A0495 Original code 1420 Description point mutation in the exon 13 creating cryptic Description splice site Date 28-Apr-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 98213565 RefAuthors Conley, M. E., Mathias, D., Treadaway, J., Minegishi, RefAuthors Y., Rohrer, J. RefTitle Mutations in Btk patients with presumed X-linked RefTitle agammaglobulinemia RefLoc Am J. Hum. Genet. 62:1034-1043(1998) Feature dna; 1 Feature /rnalink; 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 63962 Feature /change: a -> g Feature /genomic_region: exon;13 Feature /RE: +AfaI, +Csp6I, +RsaI, Feature rna; 2 Feature /dnalink; 1 Feature /aalink; 3 Feature /name: silent Feature /loc: EMBL: X58957; G312467; HSATK: 1305 Feature /codon: gga -> ggg; 3 Feature aa; 3 Feature /rnalink: 2 Feature /name: no change Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 391 Feature /change: G -> G Feature /domain: TK Symptoms classical XLA Sex XY Family history inherited // ID BTK_HUMAN; ;F404X; Occurrence 2/2 Accession K72 DBCrossRef BTKbase:A0059 Original code R525Q(3a) Description missense mutation in the exon 16 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 3) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95152522 RefAuthors Zhu, Q., Zhang, M., Winkelstein, J., Chen., S., Ochs, H.D. RefTitle Unique mutations of Bruton's tyrosine kinase in fourteen RefTitle unrelated X-linked agammaglobulinemia families RefLoc Hum. Molec. Genet. 3:1899-1900(1994) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef OMIM; 300300.0031 Feature dna; 1 Feature /rnalink: 2 Feature /name: insertion Feature /loc: EMBL: Hsu78027: unknown Feature /changeLength: +16 bp Feature /genomic_region: unknown Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: unknown Feature /codon: unknown Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature stop Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: unknown Feature /domain: TK Protein struct distortion of catalytic site; ref [2] Symptoms classical XLA Sex XY Family history inherited Relative BTK; A0060 B cells surf Ig nd // ID BTK_HUMAN; ;#F404-1; F Occurrence 1/1 Accession K74 DBCrossRef BTKbase:A0496 Original code 1426 Description deletion in the exon 14 Date 28-Apr-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 98213565 RefAuthors Conley, M. E., Mathias, D., Treadaway, J., Minegishi, RefAuthors Y., Rohrer, J. RefTitle Mutations in Btk patients with presumed X-linked RefTitle agammaglobulinemia RefLoc Am J. Hum. Genet. 62:1034-1043(1998) Feature dna; 1 Feature /rnalink; 2 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 64552 Feature /change: ttc -> Feature /genomic_region: exon;14 Feature rna; 2 Feature /dnalink; 1 Feature /aalink; 3 Feature /name: inframe Feature /loc: EMBL: X58957; G312467; HSATK: 1342..1344 Feature /codon: ttc -> -; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: deletion Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 404 Feature /change: F -> Feature /domain: TK Symptoms classical XLA Sex XY Family history inherited // ID BTK_HUMAN; ;#F404-1; F Occurrence 1/1 Accession K75 DBCrossRef BTKbase:A0497 Original code 1427 Description deletion in the exon 14 Date 28-Apr-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 98213565 RefAuthors Conley, M. E., Mathias, D., Treadaway, J., Minegishi, RefAuthors Y., Rohrer, J. RefTitle Mutations in Btk patients with presumed X-linked RefTitle agammaglobulinemia RefLoc Am J. Hum. Genet. 62:1034-1043(1998) Feature dna; 1 Feature /rnalink; 2 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 64552 Feature /change: ttc -> Feature /genomic_region: exon;14 Feature rna; 2 Feature /dnalink; 1 Feature /aalink; 3 Feature /name: inframe Feature /loc: EMBL: X58957; G312467; HSATK: 1342..1344 Feature /codon: ttc -> -; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: deletion Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 404 Feature /change: F -> Feature /domain: TK Symptoms classical XLA Sex XY Family history inherited // ID BTK_HUMAN; ;L408P; LP Occurrence 2/2 Accession K76 DBCrossRef BTKbase:A0053 Description missense mutation in the exon 14 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95152522 RefAuthors Zhu, Q., Zhang, M., Winkelstein, J., Chen., S., Ochs, H.D. RefTitle Unique mutations of Bruton's tyrosine kinase in fourteen RefTitle unrelated X-linked agammaglobulinemia families RefLoc Hum. Molec. Genet. 3:1899-1900(1994) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef OMIM; 300300.0032 DB CrossRef SWISSCHANGE; BTK_HUMAN_32 DB CrossRef SWISS-PROT; Q06187:408_408 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 64565 Feature /change: t -> c Feature /genomic_region: exon; 14 Feature /RE: +AsuC2I, +BcnI, +BsaJI, +Bsc4I, +BscBI, +BseDI, Feature /RE: +BseLI, +BsiSI, +BsiYI, +BslI, +BspLI, +BssECI, Feature /RE: +BssKI, +CauII, +HapII, +HpaII, +MspI, +MspR9I, Feature /RE: +NciI, +NgoGV, +NlaIV, +PspN4I, +ScrFI, +SecI, Feature /RE: Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1355 Feature /codon: ctg -> ccg; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 408 Feature /change: L -> P Feature /domain: TK Protein struct destroys beta-sheet structure; ref [2] Symptoms moderate XLA Sex XY Relative BTK; A0054 B cells surf Ig low // ID BTK_HUMAN; ;@T410X439; YWTIWGSEVWEMERPVRRGHQDDQRRLHVX Occurrence 1/1 Accession K78 DBCrossRef BTKbase:A0237 Original code 58 Description frameshift insertion in the exon 14 leading to Description stop codon in TK domain Date 02-Feb-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 97288998 RefAuthors Vorechovsky, I., Luo, L., Hertz., J. M., Froland, S. S., RefAuthors Fiorini, N., Quinti, I., Paganelli, R., Segers, R., RefAuthors Hammarstrom, L., Webster, A. D. B., Smith, C. I. E. RefTitle Mutation pattern in the Bruton's tyrosine kinase gene in RefTitle 26 unrelated patients with X-linked agammaglobulinemia RefLoc Hum. Mut. 9:418-425 (1997) DB CrossRef ESID; EL 0045 M81 G1 Feature dna; 1 Feature /rnalink: 2 Feature /name: insertion Feature /loc: EMBL: Hsu78027: 64570 Feature /change: +g Feature /genomic_region: exon; 14 Feature /RE: +Bse1I, +BseNI, +BsmFI, +BspGI, +BsrI, +BsrSI, Feature /RE: +FinI, +Sse9I, +TasI, +Tsp509I, +TspEI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: frameshift Feature /loc:EMBL: X58957; G312467; HSATK: 1360 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 410..439 Feature /change: TGQFGVVKYG KWRGQYDVAI KMIKEGSMSE -> Feature /change: YWTIWGSEVW EMERPVRRGH QDDQRRLHVX Feature /domain: TK mRNA level nd Protein struct premature stop Sex XY // ID BTK_HUMAN; ;G414R; GR Occurrence 1/1 Accession K79 DBCrossRef BTKbase:A0335 Original code ZT Description missense mutation in the exon 14 leading to Description amino acid change in TK domain Date 27-Aug-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (27-Aug-1996) to the BTKbase. RefLoc Dr. Michael Weiss, prof. Dr. Bernd H. Belohradsky, RefLoc Abteilung fur Infektionsimmunologia, Dr. von Haunersches RefLoc Kinderspital Klinikum Innenstadt der Universitat, Munchen, RefLoc Lindwurmstrasse 4, D-80337 Munchen, Germany, RefLoc FAX 498 951 604 928. RefLoc Dr. Elke Holinski-Feder, Dr. Alfons Meindl, Abteilung fur RefLoc Padiatrische Genetik Kinderpoliklinik, Klinikum Innenstadt RefLoc der Universitat, Munchen, Goethestrasse 29, D-80336 RefLoc Munchen, Germany. RefNumber [2] RefCrossRef MEDLINE; 98118357 RefAuthors Holinski-Feder, E., Weiss M., Brandau, O., Jedele, K. B., RefAuthors Nore, B., Beckesj", C.-M., Vihinen, M., G"tz, G., Hubbard, RefAuthors S. R., Belohradsky, B. H., Smith, C. I. E., Meindl, A. RefTitle Mutation screening of the btk gene in 56 families with RefTitle X-linked agammaglobulinemia (XLA) - 47 unique mutations RefTitle without correlation to clinical course RefLoc Pediatrics 101:276-284(1998) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 64582 Feature /change: g -> a Feature /genomic_region: exon; 14 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1372 Feature /codon: ggg -> agg; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 414 Feature /change: G -> R Feature /domain: TK Symptoms classical XLA Sex XY Age 1 IgA 0.01 IgG 0.24 IgM 0.26 CD19 2 Comment -!-Symptoms: otitis, cellulitis, airway infections // ID BTK_HUMAN; ;Y418H; YH Occurrence 1/1 Accession K80 DBCrossRef BTKbase:A0198 Original code JB Description missense mutation in the exon 14 leading to Description amino acid change in TK domain Date 25-Sep-1995 (Rel. 2, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (24-May-1995) to the BTKbase. RefLoc Dr. Hans D. Ochs, Dept of Pediatrics, University of RefLoc Washington, Seattle, WA 98195, USA, RefLoc e-mail allgau@u.washington.edu. RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_33 DB CrossRef SWISS-PROT; Q06187:418_418 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 64594 Feature /change: t -> c Feature /genomic_region: exon; 14 Feature /RE: +Hsp92II, +NlaIII, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1384 Feature /codon: tat -> cat; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 418 Feature /change: Y -> H Feature /domain: TK Protein struct disturbs domain-domain interactions; ref [2] Symptoms moderate XLA Sex XY // ID BTK_HUMAN; ;W421X; WX Occurrence 1/1 Accession K81 DBCrossRef BTKbase:A0336 Original code RM Description nonsense mutation in the exon 14 leading to Description stop codon in TK domain Date 27-Aug-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (27-Aug-1996) to the BTKbase. RefLoc Dr. Michael Weiss, prof. Dr. Bernd H. Belohradsky, RefLoc Abteilung fur Infektionsimmunologia, Dr. von Haunersches RefLoc Kinderspital Klinikum Innenstadt der Universitat, Munchen, RefLoc Lindwurmstrasse 4, D-80337 Munchen, Germany, RefLoc FAX 498 951 604 928. RefLoc Dr. Elke Holinski-Feder, Dr. Alfons Meindl, Abteilung fur RefLoc Padiatrische Genetik Kinderpoliklinik, Klinikum Innenstadt RefLoc der Universitat, Munchen, Goethestrasse 29, D-80336 RefLoc Munchen, Germany. RefNumber [2] RefCrossRef MEDLINE; 98118357 RefAuthors Holinski-Feder, E., Weiss M., Brandau, O., Jedele, K. B., RefAuthors Nore, B., Beckesj", C.-M., Vihinen, M., G"tz, G., Hubbard, RefAuthors S. R., Belohradsky, B. H., Smith, C. I. E., Meindl, A. RefTitle Mutation screening of the btk gene in 56 families with RefTitle X-linked agammaglobulinemia (XLA) - 47 unique mutations RefTitle without correlation to clinical course RefLoc Pediatrics 101:276-284(1998) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 64605 Feature /change: g -> a Feature /genomic_region: exon; 14 Feature /RE: +MboII, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1395 Feature /codon: tgg -> tga; 3 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 421 Feature /change: W -> X Feature /domain: TK Symptoms classical XLA Sex XY Age 4 IgA 0.03 IgG 1.80 IgM 0.17 CD19 0 Comment -!-Symptoms: sinusitis, airway infections // ID BTK_HUMAN; ;Y425X; YX Occurrence 1/1 Accession K82 DBCrossRef BTKbase:A0025 Original code JL6 Description nonsense mutation in the exon 14 leading to Description stop codon in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 94214435 RefAuthors de Weers, M., Mensink, R. G. J., Kraakman, M. E. M., RefAuthors Schuurman, R. K. B., Hendriks, R. W. RefTitle Mutation analysis of the Bruton's tyrosine kinase gene in RefTitle X-linked agammaglobulinemia: identification of a mutation RefTitle which affects the same codon as is altered in RefTitle immunodeficient xid mice RefLoc Hum. Molec. Genet. 3:161-166(1994) DB CrossRef OMIM; 300300.0033 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 64617 Feature /change: c -> a Feature /genomic_region: exon; 14 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1407 Feature /codon: tac -> taa; 3 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 425 Feature /change: Y -> X Feature /domain: TK Protein struct premature stop Symptoms classical XLA Sex XY Family history inherited Comment -!-Family history: affected maternal uncle // ID BTK_HUMAN; ;Y425X; YX Occurrence 1/1 Accession K83 DBCrossRef BTKbase:A0309 Original code P22 Description nonsense mutation in the exon 14 leading to Description stop codon in TK domain Date 19-Aug-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 3) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 96289505 RefAuthors Hashimoto, S., Tsukada, S., Matsushita, M., Miyawaki, T., RefAuthors Niida, Y., Yachie, A., Kobayashi, S., Iwata, T., RefAuthors Hayakawa, H., Matsuoka, H., Tsuge, I., Yamadori, T., RefAuthors Kunikata, T., Arai, S., Yoshizaki, K., Taniguchi, N., RefAuthors Kishimoto, T. RefTitle Identification of Bruton's tyrosine kinase (Btk) gene RefTitle mutations and characterization of the derived proteins in RefTitle 35 X-linked agammaglobulinemia families: a nationwide RefTitle study of Btk deficiency in Japan RefLoc Blood 88:561-573(1996) RefNumber [2] RefCrossRef MEDLINE; 98102441 RefAuthors Futatani, T., Miyawaki, T., Tsukada, S., Hashimoto, S., RefAuthors Kunikata, T., Arai, S., Kurimoto, T., Niida, Y., Matsuoka, RefAuthors H., Sakiyama, Y., Iwata, T., Tsuchiya, S., Tatsuzawa, O., RefAuthors Yoshizaki, K., Kishimoto, T. RefTitle Deficient expression of Bruton's tyrosine kinase in RefTitle monocytes from X-linked agammaglobulinemia as evaulated by RefTitle a flow cytometric analysis and its clinical application to RefTitle carrier detection RefLoc Blood 91:595-602(1998) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 64617 Feature /change: c -> a Feature /genomic_region: exon; 14 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1407 Feature /codon: tac -> taa; 3 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 425 Feature /change: Y -> X Feature /domain: TK Protein level absent; ref [2] Kinase activity inactive; ref [2] Sex XY Age 1 Ethnic origin Mongoloid; Japan Family history inherited; ref [2] IgA < 0.15 IgG 1.40 IgM < 0.30 B cells surf Ig 0 // ID BTK_HUMAN; ;I429N; IN Occurrence 1/1 Accession K84 DBCrossRef BTKbase:A0203 Description missense mutation in the exon 14 leading to Description amino acid change in TK domain Date 25-Sep-1995 (Rel. 2, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 96177680 RefAuthors Vorechovsky, I., Luo, L., Genevieve, B., Hammarstrom, L., RefAuthors Webster, A. D. B., Smith, C. I. E. RefTitle Improved oligonucleotide primer set for molecular RefTitle diagnosis of X-linked agammaglobulinemia: predominance of RefTitle amino acid substitutions in the catalytic domain of RefTitle Bruton's tyrosine kinase RefLoc Hum. Molec. Genet. 4:2403-2405(1995) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_34 DB CrossRef SWISS-PROT; Q06187:429_429 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 64628 Feature /change: t -> a Feature /genomic_region: exon; 14 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1418 Feature /codon: atc -> aac; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 429 Feature /change: I -> N Feature /domain: TK mRNA level normal Protein struct disturbs domain-domain interactions; ref [2] Sex XY // ID BTK_HUMAN; ;K430E; KE Occurrence 1/1 Accession K85 DBCrossRef BTKbase:A0003 Original code B Description missense mutation in the exon 14 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 93140868 RefAuthors Vetrie, D., Vorechovsky, I., Sideras, P. Holland, J., RefAuthors Davies, A., Flinter, F., Hammarstrom, L. Kinnon, C., RefAuthors Levinsky, R., Robrow, M., Smith, C.I.E, Bentley, D.R. RefTitle The gene involved in X-linked agammaglobulinemia is RefTitle a member of the src family of protein-tyrosine kinases RefLoc Nature 361:226-233(1993) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef OMIM; 300300.0002 DB CrossRef SWISSCHANGE; BTK_HUMAN_35 DB CrossRef SWISS-PROT; Q06187:430_430 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 64630 Feature /change: a -> g Feature /genomic_region: exon; 14 Feature /RE: +TaqI, +TthHB8I, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1420 Feature /note: generates TaqI site Feature /codon: aag -> gag; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 430 Feature /change: K -> E Feature /domain: TK Protein struct disturbs ATP binding; ref [2] Symptoms classical XLA Sex XY // ID BTK_HUMAN; ;K430E; KE Occurrence 1/1 Accession K86 DBCrossRef BTKbase:A0238 Original code 18 Description missense mutation in the exon 14 leading to Description amino acid change in TK domain Date 02-Feb-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 97288998 RefAuthors Vorechovsky, I., Luo, L., Hertz., J. M., Froland, S. S., RefAuthors Fiorini, N., Quinti, I., Paganelli, R., Segers, R., RefAuthors Hammarstrom, L., Webster, A. D. B., Smith, C. I. E. RefTitle Mutation pattern in the Bruton's tyrosine kinase gene in RefTitle 26 unrelated patients with X-linked agammaglobulinemia RefLoc Hum. Mut. 9:418-425 (1997) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef ESID; EL 0240 M57 G1 DB CrossRef SWISSCHANGE; BTK_HUMAN_35 DB CrossRef SWISS-PROT; Q06187:430_430 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 64630 Feature /change: a -> g Feature /genomic_region: exon; 14 Feature /RE: +TaqI, +TthHB8I, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1420 Feature /note: generates TaqI site Feature /codon: aag -> gag; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 430 Feature /change: K -> E Feature /domain: TK mRNA level reduced Protein struct disturbs ATP binding; ref [2] Sex XY // ID BTK_HUMAN; ;K430R; KR Occurrence 1/1 Accession K87 DBCrossRef BTKbase:A0466 Original code 14.40 Description point in the exon 14 amino acid change in domain TK Date 25-Apr-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 97092684 RefAuthors Farrar, J. E., Rohrer, J., Conley, M. E. RefTitle Neutropenia in X-linked agammaglobulinemia RefLoc Clin. Immunol. Immunopathol. 81:271-276(1996) RefNumber [2] RefCrossRef MEDLINE; 98213565 RefAuthors Conley, M. E., Mathias, D., Treadaway, J., Minegishi, RefAuthors Y., Rohrer, J. RefTitle Mutations in Btk patients with presumed X-linked RefTitle agammaglobulinemia RefLoc Am J. Hum. Genet. 62:1034-1043(1998) Feature dna; 1 Feature /rnalink; 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 64631 Feature /change: a -> g Feature /genomic_region: exon;14 Feature /RE: +BseGI, +BstF5I, +FokI, Feature rna; 2 Feature /dnalink; 1 Feature /aalink; 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1421 Feature /codon: aag -> agg; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: substitution Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 430 Feature /change: K -> R Feature /domain: TK Symptoms classical XLA Sex XY Family history de novo; ref [2] Comment -!-Symptoms: neutropenia // ID BTK_HUMAN; ;E441X; EX Occurrence 2/2 Accession K88 DBCrossRef BTKbase:A0213 Original code P14 Description nonsense mutation in the exon 14 leading to Description stop codon in TK domain Date 26-Sep-1995 (Rel. 3, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 96431154 RefAuthors Kobayashi, S., Iwata, T., Saito, M., Iwasaki, R., RefAuthors Matsumoto, H., Naritaka, S., Kono, Y., Hayashi, Y. RefTitle Mutations of the Btk gene in 12 unrelated families RefTitle with X-linked agammaglobulinemia in Japan RefLoc Hum. Genet. 97:424-430(1996) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 64663 Feature /change: g -> t Feature /genomic_region: exon; 14 Feature /RE: +AseI, +AsnI, +MseI, +PshBI, +Tru1I, +Tru9I, Feature /RE: +VspI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1453 Feature /codon: gaa -> taa; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 441 Feature /change: E -> X Feature /domain: TK Protein struct premature stop Symptoms classical XLA Sex XY Age 4 Relative BTK; A0310; cousin IgA < 0.04 IgM < 0.04 B cells surf Ig 0 // ID BTK_HUMAN; ;E445D; ED Occurrence 1/1 Accession K90 DBCrossRef BTKbase:A0498 Original code 1445 Description point in the exon 14 causing amino acid change in Description domain TK Date 28-Apr-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 98213565 RefAuthors Conley, M. E., Mathias, D., Treadaway, J., Minegishi, RefAuthors Y., Rohrer, J. RefTitle Mutations in Btk patients with presumed X-linked RefTitle agammaglobulinemia RefLoc Am J. Hum. Genet. 62:1034-1043(1998) Feature dna; 1 Feature /rnalink; 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 64677 Feature /change: a -> c Feature /genomic_region: exon;14 Feature /RE: +AcyI, +BbsI, +BbvII, +BpiI, +BpuAI, +BsaHI, Feature /RE: +BstACI, +DrdI, +DseDI, +HgaI, +Hin1I, +Hsp92I, Feature /RE: +Msp17I, Feature rna; 2 Feature /dnalink; 1 Feature /aalink; 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1467 Feature /codon: gaa -> gac; 3 Feature aa; 3 Feature /rnalink: 2 Feature /name: substitution Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 445 Feature /change: E -> D Feature /domain: TK Symptoms classical XLA Sex XY Family history inherited // ID BTK_HUMAN; ;#L452X454; LLPX Occurrence 1/1 Accession K91 DBCrossRef BTKbase:A0133 Original code 52; ZIE Description frameshift deletion in the exon 15 leading to Description stop codon in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95359977 RefAuthors Jin, H., Webster, A. D. B., Vihinen, M., Sideras, P., RefAuthors Vorechovsky, I., Hammarstrom, L., RefAuthors Bernatowska-Matuszkiewicz, E., Smith, C. I. E., Bobrow, M., RefAuthors Vetrie, D. RefTitle Identification of Btk mutations in 20 unrelated patients RefTitle with X-linked agammaglobulinemia (XLA) RefLoc Hum. Molec. Genet. 4: 693-700(1995) Feature dna; 1 Feature /rnalink: 2 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 65213..65214 Feature /change: -tt Feature /genomic_region: exon; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: frameshift Feature /loc:EMBL: X58957; G312467; HSATK: 1488..1489 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 452 Feature /change: L -> LPX Feature /domain: TK Protein struct premature stop Symptoms classical XLA Sex XY Family history inherited B cells surf Ig <1 // ID BTK_HUMAN; ;Q459X; QX Occurrence 1/1 Accession K92 DBCrossRef BTKbase:A0311 Original code P10 Description nonsense mutation in the exon 15 leading to Description stop codon in TK domain Date 19-Aug-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 3) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 96289505 RefAuthors Hashimoto, S., Tsukada, S., Matsushita, M., Miyawaki, T., RefAuthors Niida, Y., Yachie, A., Kobayashi, S., Iwata, T., RefAuthors Hayakawa, H., Matsuoka, H., Tsuge, I., Yamadori, T., RefAuthors Kunikata, T., Arai, S., Yoshizaki, K., Taniguchi, N., RefAuthors Kishimoto, T. RefTitle Identification of Bruton's tyrosine kinase (Btk) gene RefTitle mutations and characterization of the derived proteins in RefTitle 35 X-linked agammaglobulinemia families: a nationwide RefTitle study of Btk deficiency in Japan RefLoc Blood 88:561-573(1996) RefNumber [2] RefCrossRef MEDLINE; 98102441 RefAuthors Futatani, T., Miyawaki, T., Tsukada, S., Hashimoto, S., RefAuthors Kunikata, T., Arai, S., Kurimoto, T., Niida, Y., Matsuoka, RefAuthors H., Sakiyama, Y., Iwata, T., Tsuchiya, S., Tatsuzawa, O., RefAuthors Yoshizaki, K., Kishimoto, T. RefTitle Deficient expression of Bruton's tyrosine kinase in RefTitle monocytes from X-linked agammaglobulinemia as evaulated by RefTitle a flow cytometric analysis and its clinical application to RefTitle carrier detection RefLoc Blood 91:595-602(1998) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65232 Feature /change: c -> t Feature /genomic_region: exon; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1507 Feature /codon: cag -> tag; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 459 Feature /change: Q -> X Feature /domain: TK Protein level absent; ref [2] Kinase activity inactive; ref [2] Sex XY Age 5 Ethnic origin Mongoloid; Japan Family history de novo IgA 0.017 IgG 2.38 IgM 0.08 B cells surf Ig 0.1 // ID BTK_HUMAN; ;L460X; LX Occurrence 1/1 Accession K93 DBCrossRef BTKbase:A0293 Description nonsense mutation in the exon 15 leading to Description stop codon in TK domain Date 18-May-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (30-May-1996) to the BTKbase. RefLoc Dr. Hans D. Ochs, Dept of Pediatrics, University of RefLoc Washington, Seattle, WA 98195, USA, RefLoc e-mail allgau@u.washington.edu. Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65236 Feature /change: t -> a Feature /genomic_region: exon; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1511 Feature /codon: ttg -> tag; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 460 Feature /change: L -> X Feature /domain: TK Sex XY // ID BTK_HUMAN; ;L460X; LX Occurrence 1/1 Accession K94 DBCrossRef BTKbase:A0499 Description nonsense mutation in the exon 15 leading to Description stop codon in TK domain Date 28-Apr-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 98213565 RefAuthors Conley, M. E., Mathias, D., Treadaway, J., Minigichi, RefAuthors Y., Rohrer, J. RefTitle Mutations in Btk in patients with presumed X-linked RefTitle agammaglobulinemia RefLoc Am. J. Hum. Genet. 62:1034-1043(1998) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65236 Feature /change: t -> a Feature /genomic_region: exon; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1511 Feature /codon: ttg -> tag; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 460 Feature /change: L -> X Feature /domain: TK Sex XY Family history sporadic // ID BTK_HUMAN; ;G462D; GD Occurrence 1/1 Accession K95 DBCrossRef BTKbase:A0431 Original code G8301 Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 07-Sep-1997 (Rel. 5, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (07-Sep-1997) to the BTKbase. RefLoc Dr. Tracy Lester, Unit of Clinical Genetics, Institute RefLoc of Child Health, 30 Guilford Street, London, WC1N 1EH, RefLoc Tel 0171 242 9789 ext 2284, Fax 0171 404 6191 RefLoc e-mail T.Lester@ich.ucl.ac.uk Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65242 Feature /change: g -> a Feature /genomic_region: exon; 15 Feature /RE: +AatII, +MaeII, +TaiI, +TscI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1517 Feature /note: generates Aat II site Feature /codon: ggc -> gac; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 462 Feature /change: G -> D Feature /domain: TK Symptoms classical XLA Sex XY Ethnic origin Caucasoid; UK Family history inherited // ID BTK_HUMAN; ;G462V; GV Occurrence 1/1 Accession K96 DBCrossRef BTKbase:A0432 Original code G14721 Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 07-Sep-1997 (Rel. 5, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (07-Sep-1997) to the BTKbase. RefLoc Dr. Tracy Lester, Unit of Clinical Genetics, Institute RefLoc of Child Health, 30 Guilford Street, London, WC1N 1EH, RefLoc Tel 0171 242 9789 ext 2284, Fax 0171 404 6191 RefLoc e-mail T.Lester@ich.ucl.ac.uk Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65242 Feature /change: g -> t Feature /genomic_region: exon; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1517 Feature /note: destroys BsaHI site Feature /codon: ggc -> gtc; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 462 Feature /change: G -> V Feature /domain: TK Symptoms classical XLA Sex XY Age 1 Ethnic origin Caucasoid; Portugal Family history inherited IgA < 7 IgG < 8 IgM < 29.8 CD19 0 // ID BTK_HUMAN; ;#Y476X; YX Occurrence 1/1 Accession K97 DBCrossRef BTKbase:A0239 Original code 11 Description frameshift deletion in the exon 15 leading to Description stop codon in TK domain Date 02-Feb-1996 (Rel. 3, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 97288998 RefAuthors Vorechovsky, I., Luo, L., Hertz., J. M., Froland, S. S., RefAuthors Fiorini, N., Quinti, I., Paganelli, R., Segers, R., RefAuthors Hammarstrom, L., Webster, A. D. B., Smith, C. I. E. RefTitle Mutation pattern in the Bruton's tyrosine kinase gene in RefTitle 26 unrelated patients with X-linked agammaglobulinemia RefLoc Hum. Mut. 9:418-425 (1997) DB CrossRef ESID; DE 0174 M80 G1 Feature dna; 1 Feature /rnalink: 2 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 65285 Feature /change: -c Feature /genomic_region: exon; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: frameshift Feature /loc:EMBL: X58957; G312467; HSATK: 1560 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 476 Feature /change: Y -> X Feature /domain: TK mRNA level reduced Protein struct premature stop Sex XY // ID BTK_HUMAN; ;Y476D; YD Occurrence 1/1 Accession K98 DBCrossRef BTKbase:A0167 Original code D(III-2) Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95353280 RefAuthors Hagemann, T. L., Rosen, F. S., Kwan, S. P. RefTitle Characterization of germline mutations of the gene RefTitle encoding Bruton's tyrosine kinase in families with X-linked RefTitle agammaglobulinemia RefLoc Hum. Mutat. 5(4):296-302(1995) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_36 DB CrossRef SWISS-PROT; Q06187:476_476 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65283 Feature /change: t -> g Feature /genomic_region: exon; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1558 Feature /codon: tac -> gac; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 476 Feature /change: Y -> D Feature /domain: TK Protein struct affects ATP binding; ref [2] Symptoms classical XLA Sex XY Family history inherited IgA nd IgE nd IgG < 10% IgM nd B cells surf Ig nd // ID BTK_HUMAN; ;Y476D; YD Occurrence 1/1 Accession K99 DBCrossRef BTKbase:A0271 Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 13-Feb-1996 (Rel. 3, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefLoc Dr. Igor Resnick, Department of Clinical Immunology, RefLoc Research Institute for Paediatric Hematology, RefLoc Central RepublicanPaediatric Hospital, RefLoc Leninsky Pr. 117, Moscow 117513, Russia. RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_36 DB CrossRef SWISS-PROT; Q06187:476_476 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65283 Feature /change: t -> g Feature /genomic_region: exon; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1558 Feature /codon: tac -> gac; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 476 Feature /change: Y -> D Feature /domain: TK Protein struct affects ATP binding; ref [2] Symptoms classical XLA Sex XY Age 0.75 IgA 0 IgG 1.9 IgM 0.13 CD19 <1 CD20 <1 Comment -!-Symptoms: first severe infection at the age of Comment 5.5 months // ID BTK_HUMAN; ;M477R; MR Occurrence 1/1 Accession K100 DBCrossRef BTKbase:A0204 Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 25-Sep-1995 (Rel. 2, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 96177680 RefAuthors Vorechovsky, I., Luo, L., Genevieve, B., Hammarstrom, L., RefAuthors Webster, A. D. B., Smith, C. I. E. RefTitle Improved oligonucleotide primer set for molecular RefTitle diagnosis of X-linked agammaglobulinemia: predominance of RefTitle amino acid substitutions in the catalytic domain of RefTitle Bruton's tyrosine kinase RefLoc Hum. Molec. Genet. 4:2403-2405(1995) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_37 DB CrossRef SWISS-PROT; Q06187:477_477 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65287 Feature /change: t -> g Feature /genomic_region: exon; 15 Feature /RE: +AspS9I, +AsuI, +BsiZI, +Cfr13I, +Sau96I, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1562 Feature /codon: atg -> agg; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 477 Feature /change: M -> R Feature /domain: TK Protein struct affects ATP binding; ref [2] Sex XY // ID BTK_HUMAN; ;#F493X499; FSRLSSCX Occurrence 1/1 Accession K101 DBCrossRef BTKbase:A0433 Original code G8868 Description deletion in the exon 15 leading to Description stop codon in TK domain Date 07-Sep-1997 (Rel. 5, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (07-Sep-1997) to the BTKbase. RefLoc Dr. Tracy Lester, Unit of Clinical Genetics, Institute RefLoc of Child Health, 30 Guilford Street, London, WC1N 1EH, RefLoc Tel 0171 242 9789 ext 2284, Fax 0171 404 6191 RefLoc e-mail T.Lester@ich.ucl.ac.uk Feature dna; 1 Feature /rnalink: 2 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 65333 Feature /change: -c Feature /genomic_region: exon; 15 Feature /RE: +Bst4CI, +TaaI, +Tsp4CI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: frameshift Feature /loc: EMBL: X58957; G312467; HSATK: 1608 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 493 Feature /change: F -> SRLSSCX Feature /domain: TK Sex XY Family history inherited // ID BTK_HUMAN; ;Q497X; QX Occurrence 1/1 Accession K102 DBCrossRef BTKbase:A0312 Original code P2 Description nonsense mutation in the exon 15 leading to Description stop codon in TK domain Date 19-Aug-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 3) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 96289505 RefAuthors Hashimoto, S., Tsukada, S., Matsushita, M., Miyawaki, T., RefAuthors Niida, Y., Yachie, A., Kobayashi, S., Iwata, T., RefAuthors Hayakawa, H., Matsuoka, H., Tsuge, I., Yamadori, T., RefAuthors Kunikata, T., Arai, S., Yoshizaki, K., Taniguchi, N., RefAuthors Kishimoto, T. RefTitle Identification of Bruton's tyrosine kinase (Btk) gene RefTitle mutations and characterization of the derived proteins in RefTitle 35 X-linked agammaglobulinemia families: a nationwide RefTitle study of Btk deficiency in Japan RefLoc Blood 88:561-573(1996) RefNumber [2] RefCrossRef MEDLINE; 98102441 RefAuthors Futatani, T., Miyawaki, T., Tsukada, S., Hashimoto, S., RefAuthors Kunikata, T., Arai, S., Kurimoto, T., Niida, Y., Matsuoka, RefAuthors H., Sakiyama, Y., Iwata, T., Tsuchiya, S., Tatsuzawa, O., RefAuthors Yoshizaki, K., Kishimoto, T. RefTitle Deficient expression of Bruton's tyrosine kinase in RefTitle monocytes from X-linked agammaglobulinemia as evaulated by RefTitle a flow cytometric analysis and its clinical application to RefTitle carrier detection RefLoc Blood 91:595-602(1998) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65346 Feature /change: c -> t Feature /genomic_region: exon; 15 Feature /RE: +CjeI, +Fnu4HI, +Fsp4HI, +ItaI, +TseI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1621 Feature /codon: cag -> tag; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 497 Feature /change: Q -> X Feature /domain: TK Protein level absent; ref [2] Kinase activity inactive; ref [2] Sex XY Age 2.58 Ethnic origin Mongoloid; Japan Family history de novo IgA 0.05 IgG 2.00 IgM 0.25 B cells surf Ig 0.1 // ID BTK_HUMAN; ;C502X; CX Occurrence 1/1 Accession K103 DBCrossRef BTKbase:A0055 Description nonsense mutation in the exon 15 leading to Description stop codon in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95152522 RefAuthors Zhu, Q., Zhang, M., Winkelstein, J., Chen., S., Ochs, H.D. RefTitle Unique mutations of Bruton's tyrosine kinase in fourteen RefTitle unrelated X-linked agammaglobulinemia families RefLoc Hum. Molec. Genet. 3:1899-1900(1994) DB CrossRef OMIM; 300300.0034 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65363 Feature /change: c -> a Feature /genomic_region: exon; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1638 Feature /codon: tgc -> tga; 3 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 502 Feature /change: C -> X Feature /domain: TK Protein struct premature stop Symptoms classical XLA Sex XY B cells surf Ig nd // ID BTK_HUMAN; ;C502F; CF Occurrence 1/1 Accession K104 DBCrossRef BTKbase:A0182 Original code 21 Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (24-May-1995) to the BTKbase. RefLoc Dr. Hans D. Ochs, Dept of Pediatrics, University of RefLoc Washington, Seattle, WA 98195, USA, RefLoc e-mail allgau@u.washington.edu. RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_38 DB CrossRef SWISS-PROT; Q06187:502_502 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65362 Feature /change: g -> t Feature /genomic_region: exon; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1637 Feature /codon: tgc -> ttc; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 502 Feature /change: C -> F Feature /domain: TK Protein struct affects stabilizing interactions; ref [2] Symptoms moderate XLA Sex XY // ID BTK_HUMAN; ;C502F; CF Occurrence 1/1 Accession K105 DBCrossRef BTKbase:A0183 Original code 25 Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (24-May-1995) to the BTKbase. RefLoc Dr. Hans D. Ochs, Dept of Pediatrics, University of RefLoc Washington, Seattle, WA 98195, USA, RefLoc e-mail allgau@u.washington.edu. RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_38 DB CrossRef SWISS-PROT; Q06187:502_502 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65362 Feature /change: g -> t Feature /genomic_region: exon; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1637 Feature /codon: tgc -> ttc; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 502 Feature /change: C -> F Feature /domain: TK Protein struct affects stabilizing interactions; ref [2] Sex XY // ID BTK_HUMAN; ;C502W; CW Occurrence 1/1 Accession K106 DBCrossRef BTKbase:A0313 Original code P5 Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 14-Aug-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 3) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 96289505 RefAuthors Hashimoto, S., Tsukada, S., Matsushita, M., Miyawaki, T., RefAuthors Niida, Y., Yachie, A., Kobayashi, S., Iwata, T., RefAuthors Hayakawa, H., Matsuoka, H., Tsuge, I., Yamadori, T., RefAuthors Kunikata, T., Arai, S., Yoshizaki, K., Taniguchi, N., RefAuthors Kishimoto, T. RefTitle Identification of Bruton's tyrosine kinase (Btk) gene RefTitle mutations and characterization of the derived proteins in RefTitle 35 X-linked agammaglobulinemia families: a nationwide RefTitle study of Btk deficiency in Japan RefLoc Blood 88:561-573(1996) RefNumber [2] RefCrossRef MEDLINE; 98102441 RefAuthors Futatani, T., Miyawaki, T., Tsukada, S., Hashimoto, S., RefAuthors Kunikata, T., Arai, S., Kurimoto, T., Niida, Y., Matsuoka, RefAuthors H., Sakiyama, Y., Iwata, T., Tsuchiya, S., Tatsuzawa, O., RefAuthors Yoshizaki, K., Kishimoto, T. RefTitle Deficient expression of Bruton's tyrosine kinase in RefTitle monocytes from X-linked agammaglobulinemia as evaulated by RefTitle a flow cytometric analysis and its clinical application to RefTitle carrier detection RefLoc Blood 91:595-602(1998) DB CrossRef SWISSCHANGE; BTK_HUMAN_39 DB CrossRef SWISS-PROT; Q06187:502_502 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65363 Feature /change: c -> g Feature /genomic_region: exon; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1638 Feature /codon: tgc -> tgg; 3 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 502 Feature /change: C -> W Feature /domain: TK Protein level much reduced; ref [2] Kinase activity inactive; ref [2] Sex XY Age 2.75 Ethnic origin Mongoloid; Japan Family history de novo IgA < 0.06 IgG 1.95 IgM 0.37 B cells surf Ig 0.2 // ID BTK_HUMAN; ;C502W; CW Occurrence 1/1 Accession K107 DBCrossRef BTKbase:A0314 Original code P6 Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 14-Aug-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 3) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 96289505 RefAuthors Hashimoto, S., Tsukada, S., Matsushita, M., Miyawaki, T., RefAuthors Niida, Y., Yachie, A., Kobayashi, S., Iwata, T., RefAuthors Hayakawa, H., Matsuoka, H., Tsuge, I., Yamadori, T., RefAuthors Kunikata, T., Arai, S., Yoshizaki, K., Taniguchi, N., RefAuthors Kishimoto, T. RefTitle Identification of Bruton's tyrosine kinase (Btk) gene RefTitle mutations and characterization of the derived proteins in RefTitle 35 X-linked agammaglobulinemia families: a nationwide RefTitle study of Btk deficiency in Japan RefLoc Blood 88:561-573(1996) RefNumber [2] RefCrossRef MEDLINE; 98102441 RefAuthors Futatani, T., Miyawaki, T., Tsukada, S., Hashimoto, S., RefAuthors Kunikata, T., Arai, S., Kurimoto, T., Niida, Y., Matsuoka, RefAuthors H., Sakiyama, Y., Iwata, T., Tsuchiya, S., Tatsuzawa, O., RefAuthors Yoshizaki, K., Kishimoto, T. RefTitle Deficient expression of Bruton's tyrosine kinase in RefTitle monocytes from X-linked agammaglobulinemia as evaulated by RefTitle a flow cytometric analysis and its clinical application to RefTitle carrier detection RefLoc Blood 91:595-602(1998) DB CrossRef SWISSCHANGE; BTK_HUMAN_39 DB CrossRef SWISS-PROT; Q06187:502_502 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65363 Feature /change: c -> g Feature /genomic_region: exon; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1638 Feature /codon: tgc -> tgg; 3 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 502 Feature /change: C -> W Feature /domain: TK Protein level absent; ref [2] Kinase activity inactive; ref [2] Sex XY Age 5 Ethnic origin Mongoloid; Japan Family history inherited IgA 0.05 IgG 1.11 IgM 0.20 B cells surf Ig 0 // ID BTK_HUMAN; ;C506R; CR Occurrence 1/1 Accession K108 DBCrossRef BTKbase:A0071 Original code 79 Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95152493 RefAuthors Hagemann, T. L., Chen, Y., Rosen, F. S., Kwan, S. RefTitle Genomic organization of the Btk gene and exon scanning for RefTitle mutations in the patients with X-linked RefTitle agammaglobulinemia RefLoc Hum. Molec. Genet. 3:1743-1749(1994) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef OMIM; 300300.0035 DB CrossRef SWISSCHANGE; BTK_HUMAN_40 DB CrossRef SWISS-PROT; Q06187:506_506 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65373 Feature /change: t -> c Feature /genomic_region: exon; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1648 Feature /codon: tgt -> cgt; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 506 Feature /change: C -> R Feature /domain: TK Protein struct affects stabilizing interactions, charge effect; ref [2] Symptoms classical XLA Sex XY Family history inherited IgA hd IgE hd IgG < 10% IgM hd B cells surf Ig nd // ID BTK_HUMAN; ;C506R; CR Occurrence 1/1 Accession K109 DBCrossRef BTKbase:A0289 Original code 166; 4-15-8 Description missense mutation in the exon 15 Description amino acid change in TK domain Date 15-May-1996 (Rel. 3, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (15-May-1996) to the BTKbase RefLoc Dr. Jerrold H. Schwaber, Hahnemann University, Broad & Wine RefLoc Philadelphia, PA 19102, USA, RefLoc e-mail schwaberj@hal.hahnemann.edu. RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_40 DB CrossRef SWISS-PROT; Q06187:506_506 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65373 Feature /change: t -> c Feature /genomic_region: exon; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1648 Feature /codon: tgt -> cgt; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 506 Feature /change: C -> R Feature /domain: TK Protein struct affects stabilizing interactions, charge effect; ref [2] Symptoms mild XLA Sex XY Age 0.83 Family history inherited IgA nd IgG 10 IgM 45 B cells surf Ig 8 // ID BTK_HUMAN; ;C506Y; CY Occurrence 1/1 Accession K110 DBCrossRef BTKbase:A0026 Original code Z122 Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 94214435 RefAuthors de Weers, M., Mensink, R. G. J., Kraakman, M. E. M., RefAuthors Schuurman, R. K. B., Hendriks, R. W. RefTitle Mutation analysis of the Bruton's tyrosine kinase gene in RefTitle X-linked agammaglobulinemia: identification of a mutation RefTitle which affects the same codon as is altered in RefTitle immunodeficient xid mice RefLoc Hum. Molec. Genet. 3:161-166(1994) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_41 DB CrossRef SWISS-PROT; Q06187:506_506 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65374 Feature /change: g -> a Feature /genomic_region: exon; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1649 Feature /codon: tgt -> tat; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 506 Feature /change: C -> Y Feature /domain: TK Protein struct affects stabilizing interactions; ref [2] Sex XY Family history inherited Comment -!-Family history: mutation introduced by a healthy male Comment (mosaicism) // ID BTK_HUMAN; ;C506Y; CY Occurrence 1/1 Accession K111 DBCrossRef BTKbase:A0184 Original code PK Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (24-May-1995) to the BTKbase. RefLoc Dr. Hans D. Ochs, Dept of Pediatrics, University of RefLoc Washington, Seattle, WA 98195, USA, RefLoc e-mail allgau@u.washington.edu. RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_41 DB CrossRef SWISS-PROT; Q06187:506_506 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65374 Feature /change: g -> a Feature /genomic_region: exon; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1649 Feature /codon: tgt -> tat; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 506 Feature /change: C -> Y Feature /domain: TK Protein struct affects stabilizing interactions; ref [2] Symptoms classical XLA Sex XY Family history inherited // ID BTK_HUMAN; ;C506Y; CY Occurrence 1/1 Accession K112 DBCrossRef BTKbase:A0240 Original code 15/22 Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 02-Feb-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 97288998 RefAuthors Vorechovsky, I., Luo, L., Hertz., J. M., Froland, S. S., RefAuthors Fiorini, N., Quinti, I., Paganelli, R., Segers, R., RefAuthors Hammarstrom, L., Webster, A. D. B., Smith, C. I. E. RefTitle Mutation pattern in the Bruton's tyrosine kinase gene in RefTitle 26 unrelated patients with X-linked agammaglobulinemia RefLoc Hum. Mut. 9:418-425 (1997) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef ESID; IT 0437 M94 G1 DB CrossRef SWISSCHANGE; BTK_HUMAN_41 DB CrossRef SWISS-PROT; Q06187:506_506 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65374 Feature /change: g -> a Feature /genomic_region: exon; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1649 Feature /codon: tgt -> tat; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 506 Feature /change: C -> Y Feature /domain: TK mRNA level normal Protein struct affects stabilizing interactions; ref [2] Sex XY Family history inherited // ID BTK_HUMAN; ;C506Y; CY Occurrence 1/1 Accession K113 DBCrossRef BTKbase:A0241 Original code 36 Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 02-Feb-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 97288998 RefAuthors Vorechovsky, I., Luo, L., Hertz., J. M., Froland, S. S., RefAuthors Fiorini, N., Quinti, I., Paganelli, R., Segers, R., RefAuthors Hammarstrom, L., Webster, A. D. B., Smith, C. I. E. RefTitle Mutation pattern in the Bruton's tyrosine kinase gene in RefTitle 26 unrelated patients with X-linked agammaglobulinemia RefLoc Hum. Mut. 9:418-425 (1997) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef ESID; CH 0046 M71 G1 DB CrossRef SWISSCHANGE; BTK_HUMAN_41 DB CrossRef SWISS-PROT; Q06187:506_506 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65374 Feature /change: g -> a Feature /genomic_region: exon; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1649 Feature /codon: tgt -> tat; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 506 Feature /change: C -> Y Feature /domain: TK mRNA level normal Protein struct affects stabilizing interactions; ref [2] Sex XY Family history inherited // ID BTK_HUMAN; ;C506Y; CY Occurrence 1/1 Accession K114 DBCrossRef BTKbase:A0378 Description missense mutation in exon 15 leading to Description amino acid change in TK domain Date 15-May-1997 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (27-Aug-1996) to the BTKbase. RefLoc Dr. Michael Weiss, prof. Dr. Bernd H. Belohradsky, RefLoc Abteilung fur Infektionsimmunologia, Dr. von Haunersches RefLoc Kinderspital Klinikum Innenstadt der Universitat, Munchen, RefLoc Lindwurmstrasse 4, D-80337 Munchen, Germany, RefLoc FAX 498 951 604 928. RefLoc Dr. Elke Holinski-Feder, Dr. Alfons Meindl, Abteilung fur RefLoc Padiatrische Genetik Kinderpoliklinik, Klinikum Innenstadt RefLoc der Universitat, Munchen, Goethestrasse 29, D-80336 RefLoc Munchen, Germany. RefNumber [2] RefCrossRef MEDLINE; 98118357 RefAuthors Holinski-Feder, E., Weiss M., Brandau, O., Jedele, K. B., RefAuthors Nore, B., Beckesj", C.-M., Vihinen, M., G"tz, G., Hubbard, RefAuthors S. R., Belohradsky, B. H., Smith, C. I. E., Meindl, A. RefTitle Mutation screening of the btk gene in 56 families with RefTitle X-linked agammaglobulinemia (XLA) - 47 unique mutations RefTitle without correlation to clinical course RefLoc Pediatrics 101:276-284(1998) DB CrossRef SWISSCHANGE; BTK_HUMAN_41 DB CrossRef SWISS-PROT; Q06187:506_506 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65374 Feature /change: g -> a Feature /genomic_region: exon; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1649 Feature /codon: tgt -> tat; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 506 Feature /change: C -> Y Feature /domain: TK Sex XY // ID BTK_HUMAN; ;M509I; MI Occurrence 1/1 Accession K115 DBCrossRef BTKbase:A0257 Original code 14.7; M509V(2) Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 09-Jan-1996 (Rel. 3, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 96007207 RefAuthors Conley, M. E., Rohrer, J. RefTitle The spectrum of mutations in Btk that cause X-linked RefTitle agammaglobulinemia RefLoc Clin. Immunol. Immunopathol. 76:S192-S197(1995) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_42 DB CrossRef SWISS-PROT; Q06187:509_509 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65384 Feature /change: g -> a Feature /genomic_region: exon; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1659 Feature /codon: atg -> ata; 3 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 509 Feature /change: M -> I Feature /domain: TK Protein struct affects stabilation of catalytic loop; ref [2] Sex XY Family history inherited // ID BTK_HUMAN; ;M509I; MI Occurrence 1/1 Accession K116 DBCrossRef BTKbase:A0467 Original code 14.71 Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 21-Apr-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 97092684 RefAuthors Farrar, J. E., Rohrer, J., Conley, M. E.. RefTitle Neutropenia in X-linked agammaglobulinemia RefLoc Clin. Immunol. Immunopathol. 81:271-276(1996) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65384 Feature /change: g -> a Feature /genomic_region: exon; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1659 Feature /codon: atg -> ata; 3 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 509 Feature /change: M -> I Feature /domain: TK Protein struct affects stabilation of catalytic loop; ref [2] Sex XY Family history sproradic Comment -!-Symptoms: neutropenia // ID BTK_HUMAN; ;M509V; MV Occurrence 1/1 Accession K117 DBCrossRef BTKbase:A0117 Original code 19/10 Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95227177 RefAuthors Vorechovsky, I., Vihinen, M., de Saint Basile, G., RefAuthors Honsova, S., Hammarstrom, L., Muller, S., Nilsson, L., RefAuthors Fischer, A., Smith, C. I. E. RefTitle DNA-based mutation analysis of Bruton's tyrosine gene RefTitle in patients with X-linked agammaglobulinemia RefLoc Hum. Molec. Genet. 4:51-58(1995) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65382 Feature /change: a -> g Feature /genomic_region: exon; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1657 Feature /codon: atg -> gtg; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 509 Feature /change: M -> V Feature /domain: TK Protein struct affects stabilation of catalytic loop; ref [2] Sex XY Family history inherited // ID BTK_HUMAN; ;Y511X; YX Occurrence 1/1 Accession K118 DBCrossRef BTKbase:A0134 Original code 24 Description nonsense mutation in the exon 15 Description leading to stop codon in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95359977 RefAuthors Jin, H., Webster, A. D. B., Vihinen, M., Sideras, P., RefAuthors Vorechovsky, I., Hammarstrom, L., RefAuthors Bernatowska-Matuszkiewicz, E., Smith, C. I. E., Bobrow, M., RefAuthors Vetrie, D. RefTitle Identification of Btk mutations in 20 unrelated patients RefTitle with X-linked agammaglobulinemia (XLA) RefLoc Hum. Molec. Genet. 4: 693-700(1995) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65390 Feature /change: c -> a Feature /genomic_region: exon; 15 Feature /RE: +Bse1I, +BseNI, +BsrI, +BsrSI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1665 Feature /codon: tac -> taa; 3 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 511 Feature /change: Y -> X Feature /domain: TK Protein struct premature stop Symptoms moderate XLA Sex XY Age 1 Family history inherited IgA < 0.1 IgG < 0.3 IgM < 0.1 B cells surf Ig 3 // ID BTK_HUMAN; ;@Y511X; YX Occurrence 3/3 Accession K119 DBCrossRef BTKbase:A0214 Original code P1-1 Description frameshift insertion in the exon 15 leading to Description stop codon in TK domain Date 26-Sep-1995 (Rel. 3, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 3) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 96431154 RefAuthors Kobayashi, S., Iwata, T., Saito, M., Iwasaki, R., RefAuthors Matsumoto, H., Naritaka, S., Kono, Y., Hayashi, Y. RefTitle Mutations of the Btk gene in 12 unrelated families RefTitle with X-linked agammaglobulinemia in Japan RefLoc Hum. Genet. 97:424-430(1996) RefNumber [2] RefCrossRef MEDLINE; 98102441 RefAuthors Futatani, T., Miyawaki, T., Tsukada, S., Hashimoto, S., RefAuthors Kunikata, T., Arai, S., Kurimoto, T., Niida, Y., Matsuoka, RefAuthors H., Sakiyama, Y., Iwata, T., Tsuchiya, S., Tatsuzawa, O., RefAuthors Yoshizaki, K., Kishimoto, T. RefTitle Deficient expression of Bruton's tyrosine kinase in RefTitle monocytes from X-linked agammaglobulinemia as evaulated by RefTitle a flow cytometric analysis and its clinical application to RefTitle carrier detection RefLoc Blood 91:595-602(1998) Feature dna; 1 Feature /rnalink: 2 Feature /name: insertion Feature /loc: EMBL: Hsu78027: 65388 Feature /change: +gaat Feature /genomic_region: exon; 15 Feature /RE: +BpmI, +BsiLI, +BssKI, +Bst2UI, +BstNI, +BstOI, Feature /RE: +EcoRII, +GsuI, +HinfI, +MboII, +MspR9I, +MvaI, Feature /RE: +PleI, +PpsI, +SchI, +ScrFI, +Sse9I, +TasI, Feature /RE: +Tsp509I, +TspEI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: frameshift Feature /loc:EMBL: X58957; G312467; HSATK: 1663 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 511 Feature /change: Y -> X Feature /domain: TK Protein level absent; ref [2] Kinase activity inactive; ref [2] Protein struct premature stop Symptoms classical XLA Sex XY Age 2 Family history inherited Relative BTK; A0215; brother Relative BTK; A0216; uncle IgA nd IgG nd IgM 0.29 B cells surf Ig 1 // ID BTK_HUMAN; ;L518R; LR Occurrence 1/1 Accession K122 DBCrossRef BTKbase:A0539 Original code JF Description missense mutation in the exon 15 leading to Description amino acid change in PH domain Date 26-Oct-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (26-Oct-1998) to BTKbase. RefLoc Prof. Hans D. Ochs, Department of Pediatrics, Box RefLoc 356320, University of Washington, School of Medicine RefLoc Seattle, WA 98195-6320, e-mail allgau@u.washington.edu, RefLoc fax: 206 543 3184 Feature dna; 1 Feature /rnalink; 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65410 Feature /change: t -> g Feature /genomic_region: exon;15 Feature /RE: +MaeIII, +Tsp45I, Feature rna; 2 Feature /dnalink; 1 Feature /aalink; 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1685 Feature /codon: ctt -> cgt; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 518 Feature /change: L -> R Feature /domain: TK Symptoms classical XLA // ID BTK_HUMAN; ;R520X; RX Occurrence 1/1 Accession K123 DBCrossRef BTKbase:A0072 Original code 326 Description nonsense mutation in the exon 15 leading to Description stop codon in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95152493 RefAuthors Hagemann, T. L., Chen, Y., Rosen, F. S., Kwan, S. RefTitle Genomic organization of the Btk gene and exon scanning for RefTitle mutations in the patients with X-linked RefTitle agammaglobulinemia RefLoc Hum. Molec. Genet. 3:1743-1749(1994) DB CrossRef OMIM; 300300.0036 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65415 Feature /change: c -> t Feature /CpG; 1 Feature /genomic_region: exon; 15 Feature /RE: +BstDEI, +DdeI, +TspRI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1690 Feature /codon: cga -> tga; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 520 Feature /change: R -> X Feature /domain: TK Protein struct premature stop Symptoms classical XLA Sex XY Family history inherited IgA hd IgE hd IgG < 10% IgM hd B cells surf Ig nd Comment -!-Family history: 3 patients // ID BTK_HUMAN; ;R520X; RX Occurrence 2/2 Accession K124 DBCrossRef BTKbase:A0056 Description nonsense mutation in the exon 15 leading to Description stop codon in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95152522 RefAuthors Zhu, Q., Zhang, M., Winkelstein, J., Chen., S., Ochs, H.D. RefTitle Unique mutations of Bruton's tyrosine kinase in fourteen RefTitle unrelated X-linked agammaglobulinemia families RefLoc Hum. Molec. Genet. 3:1899-1900(1994) DB CrossRef OMIM; 300300.0036 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65415 Feature /change: c -> t Feature /CpG; 1 Feature /genomic_region: exon; 15 Feature /RE: +BstDEI, +DdeI, +TspRI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1690 Feature /codon: cga -> tga; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 520 Feature /change: R -> X Feature /domain: TK Protein struct premature stop Symptoms moderate XLA Sex XY Family history inherited Relative BTK; A0057 B cells surf Ig low // ID BTK_HUMAN; ;R520X; RX Occurrence 1/1 Accession K126 DBCrossRef BTKbase:A0091 Original code 17 Description nonsense mutation in the exon 15 leading to Description stop codon in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95152494 RefAuthors Conley, M. E., Fitch-Hilgenberg, M. E., Cleveland, J. L. RefAuthors Parolini, O., Rohrer, J. RefTitle Screening of genomic DNA to indentify mutations in the RefTitle gene for Bruton's tyrosine kinase RefLoc Hum. Molec. Genet. 3: 1751-1756(1994) RefNumber [2] RefCrossRef MEDLINE; 97092684 RefAuthors Farrar, J.E., Rohrer, J., Conley, M.-E. RefTitle Neutropenia in X-linked agammaglobulinemia RefLoc Clin. Immunol. Immunopathol. 81:271-276(1996) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65415 Feature /change: c -> t Feature /CpG; 1 Feature /genomic_region: exon; 15 Feature /RE: +BstDEI, +DdeI, +TspRI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1690 Feature /codon: cga -> tga; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 520 Feature /change: R -> X Feature /domain: TK mRNA level absent Protein struct premature stop Symptoms mild XLA Sex XY Family history de novo B cells surf Ig <1 Comment -!-Symptoms: neutropenia; ref [2] // ID BTK_HUMAN; ;R520X; RX Occurrence 1/1 Accession K127 DBCrossRef BTKbase:A0217 Original code P3 Description nonsense mutation in the exon 15 leading to Description stop codon in TK domain Date 26-Sep-1995 (Rel. 3, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 96431154 RefAuthors Kobayashi, S., Iwata, T., Saito, M., Iwasaki, R., RefAuthors Matsumoto, H., Naritaka, S., Kono, Y., Hayashi, Y. RefTitle Mutations of the Btk gene in 12 unrelated families RefTitle with X-linked agammaglobulinemia in Japan RefLoc Hum. Genet. 97:424-430(1996) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65415 Feature /change: c -> t Feature /CpG; 1 Feature /genomic_region: exon; 15 Feature /RE: +BstDEI, +DdeI, +TspRI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1690 Feature /codon: cga -> tga; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 520 Feature /change: R -> X Feature /domain: TK Protein struct premature stop Symptoms classical XLA Sex XY Age 1.75 Family history inherited IgA < 0.05 IgG < 0.32 IgM < 0.06 B cells surf Ig 1 // ID BTK_HUMAN; ;R520X; RX Occurrence 1/1 Accession K128 DBCrossRef BTKbase:A0242 Original code 35 Description nonsense mutation in the exon 15 leading to Description amino acid change in TK domain Date 02-Feb-1996 (Rel. 3, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 97288998 RefAuthors Vorechovsky, I., Luo, L., Hertz., J. M., Froland, S. S., RefAuthors Fiorini, N., Quinti, I., Paganelli, R., Segers, R., RefAuthors Hammarstrom, L., Webster, A. D. B., Smith, C. I. E. RefTitle Mutation pattern in the Bruton's tyrosine kinase gene in RefTitle 26 unrelated patients with X-linked agammaglobulinemia RefLoc Hum. Mut. 9:418-425 (1997) DB CrossRef ESID; CH 0533 M74 G1 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65415 Feature /change: c -> t Feature /CpG; 1 Feature /genomic_region: exon; 15 Feature /RE: +BstDEI, +DdeI, +TspRI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1690 Feature /codon: cga -> tga; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 520 Feature /change: R -> X Feature /domain: TK Protein struct premature stop Sex XY Family history inherited // ID BTK_HUMAN; ;R520X; RX Occurrence 1/1 Accession K129 DBCrossRef BTKbase:A0337 Original code SJ Description nonsense mutation in the exon 15 leading to Description amino acid change in TK domain Date 27-Aug-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (27-Aug-1996) to the BTKbase. RefLoc Dr. Michael Weiss, prof. Dr. Bernd H. Belohradsky, RefLoc Abteilung fur Infektionsimmunologia, Dr. von Haunersches RefLoc Kinderspital Klinikum Innenstadt der Universitat, Munchen, RefLoc Lindwurmstrasse 4, D-80337 Munchen, Germany, RefLoc FAX 498 951 604 928. RefLoc Dr. Elke Holinski-Feder, Dr. Alfons Meindl, Abteilung fur RefLoc Padiatrische Genetik Kinderpoliklinik, Klinikum Innenstadt RefLoc der Universitat, Munchen, Goethestrasse 29, D-80336 RefLoc Munchen, Germany. RefNumber [2] RefCrossRef MEDLINE; 98118357 RefAuthors Holinski-Feder, E., Weiss M., Brandau, O., Jedele, K. B., RefAuthors Nore, B., Beckesj", C.-M., Vihinen, M., G"tz, G., Hubbard, RefAuthors S. R., Belohradsky, B. H., Smith, C. I. E., Meindl, A. RefTitle Mutation screening of the btk gene in 56 families with RefTitle X-linked agammaglobulinemia (XLA) - 47 unique mutations RefTitle without correlation to clinical course RefLoc Pediatrics 101:276-284(1998) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65415 Feature /change: c -> t Feature /CpG; 1 Feature /genomic_region: exon; 15 Feature /RE: +BstDEI, +DdeI, +TspRI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1690 Feature /codon: cga -> tga; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 520 Feature /change: R -> X Feature /domain: TK Symptoms classical XLA Sex XY Age 7 Family history inherited IgA 0.10 IgG 2.30 IgM 0.20 CD19 1 Comment -!-Symptoms: airway infections, bronciectasis, Comment encephalopathy // ID BTK_HUMAN; ;R520X; RX Occurrence 1/1 Accession K130 DBCrossRef BTKbase:A0361 Original code G8306 Description nonsense mutation in the exon 15 leading to Description amino acid change in TK domain Date 06-Sep-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (06-Sep-1996) to the BTKbase. RefLoc Dr. Tracy Lester, Unit of Clinical Genetics, Institute RefLoc of Child Health, 30 Guilford Street, London, WC1N 1EH, RefLoc Tel 0171 242 9789 ext 2284, Fax 0171 404 6191 RefLoc e-mail T.Lester@ich.ucl.ac.uk Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65415 Feature /change: c -> t Feature /CpG; 1 Feature /genomic_region: exon; 15 Feature /RE: +BstDEI, +DdeI, +TspRI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1690 Feature /note: generates Dde I site Feature /codon: cga -> tga; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 520 Feature /change: R -> X Feature /domain: TK Sex XY Family history inherited Comment -!-Family history: two affected half-brothers // ID BTK_HUMAN; ;R520X; RX Occurrence 1/1 Accession K131 DBCrossRef BTKbase:A0362 Original code G11469 Description nonsense mutation in the exon 15 leading to Description amino acid change in TK domain Date 06-Sep-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (06-Sep-1996) to the BTKbase. RefLoc Dr. Tracy Lester, Unit of Clinical Genetics, Institute RefLoc of Child Health, 30 Guilford Street, London, WC1N 1EH, RefLoc Tel 0171 242 9789 ext 2284, Fax 0171 404 6191 RefLoc e-mail T.Lester@ich.ucl.ac.uk Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65415 Feature /change: c -> t Feature /CpG; 1 Feature /genomic_region: exon; 15 Feature /RE: +BstDEI, +DdeI, +TspRI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1690 Feature /note: generates Dde I site Feature /codon: cga -> tga; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 520 Feature /change: R -> X Feature /domain: TK Sex XY Age 5 Family history inherited B cells surf Ig nd Comment -!-Symptoms: recurrent infections, pneumococcal meningitis Comment -!-Family history: 4 affected males in 2 generations // ID BTK_HUMAN; ;R520X; RX Occurrence 1/1 Accession K132 DBCrossRef BTKbase:A0383 Description nonsense mutation in the exon 15 leading to Description amino acid change in TK domain Date 15-May-1997 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (27-Aug-1996) to the BTKbase. RefLoc Dr. Michael Weiss, prof. Dr. Bernd H. Belohradsky, RefLoc Abteilung fur Infektionsimmunologia, Dr. von Haunersches RefLoc Kinderspital Klinikum Innenstadt der Universitat, Munchen, RefLoc Lindwurmstrasse 4, D-80337 Munchen, Germany, RefLoc FAX 498 951 604 928. RefLoc Dr. Elke Holinski-Feder, Dr. Alfons Meindl, Abteilung fur RefLoc Padiatrische Genetik Kinderpoliklinik, Klinikum Innenstadt RefLoc der Universitat, Munchen, Goethestrasse 29, D-80336 RefLoc Munchen, Germany. RefNumber [2] RefCrossRef MEDLINE; 98118357 RefAuthors Holinski-Feder, E., Weiss M., Brandau, O., Jedele, K. B., RefAuthors Nore, B., Beckesj", C.-M., Vihinen, M., G"tz, G., Hubbard, RefAuthors S. R., Belohradsky, B. H., Smith, C. I. E., Meindl, A. RefTitle Mutation screening of the btk gene in 56 families with RefTitle X-linked agammaglobulinemia (XLA) - 47 unique mutations RefTitle without correlation to clinical course RefLoc Pediatrics 101:276-284(1998) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65415 Feature /change: c -> t Feature /CpG; 1 Feature /genomic_region: exon; 15 Feature /RE: +BstDEI, +DdeI, +TspRI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1690 Feature /codon: cga -> tga; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 520 Feature /change: R -> X Feature /domain: TK Symptoms classical XLA Sex XY // ID BTK_HUMAN; ;R520X; RX Occurrence 1/1 Accession K133 DBCrossRef BTKbase:A0414 Description nonsense mutation in the exon 15 leading to Description amino acid change in TK domain Date 20-Aug-1997 (Rel. 5, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (20-Aug-1997) to the BTKbase. RefLoc Dr. Michael Weiss, prof. Dr. Bernd H. Belohradsky, RefLoc Abteilung fur Infektionsimmunologia, Dr. von Haunersches RefLoc Kinderspital Klinikum Innenstadt der Universitat, Munchen, RefLoc Lindwurmstrasse 4, D-80337 Munchen, Germany, RefLoc FAX 498 951 604 928. RefLoc Dr. Elke Holinski-Feder, Dr. Alfons Meindl, Abteilung fur RefLoc Padiatrische Genetik Kinderpoliklinik, Klinikum Innenstadt RefLoc der Universitat, Munchen, Goethestrasse 29, D-80336 RefLoc Munchen, Germany. Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65415 Feature /change: c -> t Feature /CpG; 1 Feature /genomic_region: exon; 15 Feature /RE: +BstDEI, +DdeI, +TspRI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1690 Feature /note: generates Dde I site Feature /codon: cga -> tga; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 520 Feature /change: R -> X Feature /domain: TK Sex XY // ID BTK_HUMAN; ;R520X; RX Occurrence 1/1 Accession K134 DBCrossRef BTKbase:A0434 Original code G16023 Description nonsense mutation in the exon 15 leading to Description amino acid change in TK domain Date 07-Sep-1997 (Rel. 5, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (07-Sep-1997) to the BTKbase. RefLoc Dr. Tracy Lester, Unit of Clinical Genetics, Institute RefLoc of Child Health, 30 Guilford Street, London, WC1N 1EH, RefLoc Tel 0171 242 9789 ext 2284, Fax 0171 404 6191 RefLoc e-mail T.Lester@ich.ucl.ac.uk Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65415 Feature /change: c -> t Feature /CpG; 1 Feature /genomic_region: exon; 15 Feature /RE: +BstDEI, +DdeI, +TspRI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1690 Feature /note: generates Dde I site Feature /codon: cga -> tga; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 520 Feature /change: R -> X Feature /domain: TK Symptoms classical XLA Sex XY Ethnic origin Caucasoid; UK Family history inherited // ID BTK_HUMAN; ;R520Q; RQ Occurrence 1/1 Accession K135 DBCrossRef BTKbase:A0073 Original code 72 Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95152493 RefAuthors Hagemann, T. L., Chen, Y., Rosen, F. S., Kwan, S. RefTitle Genomic organization of the Btk gene and exon scanning for RefTitle mutations in the patients with X-linked RefTitle agammaglobulinemia RefLoc Hum. Molec. Genet. 3:1743-1749(1994) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef OMIM; 300300.0037 DB CrossRef SWISSCHANGE; BTK_HUMAN_44 DB CrossRef SWISS-PROT; Q06187:520_520 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65416 Feature /change: g -> a Feature /CpG; 2 Feature /genomic_region: exon; 15 Feature /RE: +AccB7I, +PflMI, +Van91I, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1691 Feature /codon: cga -> caa; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 520 Feature /change: R -> Q Feature /domain: TK Protein struct affects phosphotyrosine binding; ref [2] Symptoms classical XLA Sex XY Family history inherited IgA hd IgE hd IgG < 10% IgM hd B cells surf Ig nd // ID BTK_HUMAN; ;R520Q; RQ Occurrence 1/1 Accession K136 DBCrossRef BTKbase:A0058 Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) RefNumber [2] RefCrossRef MEDLINE; 95152522 RefAuthors Zhu, Q., Zhang, M., Winkelstein, J., Chen., S., Ochs, H.D. RefTitle Unique mutations of Bruton's tyrosine kinase in fourteen RefTitle unrelated X-linked agammaglobulinemia families RefLoc Hum. Molec. Genet. 3:1899-1900(1994) DB CrossRef OMIM; 300300.0037 DB CrossRef SWISSCHANGE; BTK_HUMAN_44 DB CrossRef SWISS-PROT; Q06187:520_520 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65416 Feature /change: g -> a Feature /CpG; 2 Feature /genomic_region: exon; 15 Feature /RE: +AccB7I, +PflMI, +Van91I, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1691 Feature /codon: cga -> caa; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 520 Feature /change: R -> Q Feature /domain: TK Protein struct affects phosphotyrosine binding; ref [1] Symptoms classical XLA Sex XY Family history inherited B cells surf Ig nd // ID BTK_HUMAN; ;R520Q; RQ Occurrence 1/1 Accession K137 DBCrossRef BTKbase:A0092 Original code 15 Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95152494 RefAuthors Conley, M. E., Fitch-Hilgenberg, M. E., Cleveland, J. L. RefAuthors Parolini, O., Rohrer, J. RefTitle Screening of genomic DNA to indentify mutations in the RefTitle gene for Bruton's tyrosine kinase RefLoc Hum. Molec. Genet. 3: 1751-1756(1994) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_44 DB CrossRef SWISS-PROT; Q06187:520_520 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65416 Feature /change: g -> a Feature /CpG; 2 Feature /genomic_region: exon; 15 Feature /RE: +AccB7I, +PflMI, +Van91I, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1691 Feature /codon: cga -> caa; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 520 Feature /change: R -> Q Feature /domain: TK Protein struct affects phosphotyrosine binding; ref [2] Symptoms classical XLA Sex XY Family history inherited B cells surf Ig <1 // ID BTK_HUMAN; ;R520Q; RQ Occurrence 1/1 Accession K138 DBCrossRef BTKbase:A0093 Original code 16 Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95152494 RefAuthors Conley, M. E., Fitch-Hilgenberg, M. E., Cleveland, J. L. RefAuthors Parolini, O., Rohrer, J. RefTitle Screening of genomic DNA to indentify mutations in the RefTitle gene for Bruton's tyrosine kinase RefLoc Hum. Molec. Genet. 3: 1751-1756(1994) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_44 DB CrossRef SWISS-PROT; Q06187:520_520 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65416 Feature /change: g -> a Feature /CpG; 2 Feature /genomic_region: exon; 15 Feature /RE: +AccB7I, +PflMI, +Van91I, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1691 Feature /codon: cga -> caa; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 520 Feature /change: R -> Q Feature /domain: TK mRNA level normal Protein struct affects phosphotyrosine binding; ref [2] Symptoms classical XLA Sex XY Family history inherited B cells surf Ig <1 // ID BTK_HUMAN; ;R520Q; RQ Occurrence 1/1 Accession K139 DBCrossRef BTKbase:A0155 Original code FM; 12 Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95359987 RefAuthors Gaspar, H. B., Bradley, L. A. D., Katz, F., Lovering, R. RefAuthors C., Roifman, C. M., Morgan, G., Levinsky, R. J., RefAuthors Kinnon, C. RefTitle Mutation analysis in Bruton's tyrosine kinase, the X- RefTitle linked agammaglobulinemia, including identification of an RefTitle insertional hotspot RefLoc Hum. Molec. Genet. 4: 755-757(1995) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_44 DB CrossRef SWISS-PROT; Q06187:520_520 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65416 Feature /change: g -> a Feature /CpG; 2 Feature /genomic_region: exon; 15 Feature /RE: +AccB7I, +PflMI, +Van91I, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1691 Feature /note: generates PflMI site Feature /codon: cga -> caa; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 520 Feature /change: R -> Q Feature /domain: TK Protein struct affects phosphotyrosine binding; ref [2] Symptoms classical XLA Sex XY Family history inherited Comment -!-Family history: 2 affected brothers // ID BTK_HUMAN; ;R520Q; RQ Occurrence 1/1 Accession K140 DBCrossRef BTKbase:A0195 Original code 124 Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 25-Sep-1995 (Rel. 2, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95152493 RefAuthors Hagemann, T. L., Chen, Y., Rosen, F. S., Kwan, S. RefTitle Genomic organization of the Btk gene and exon scanning for RefTitle mutations in the patients with X-linked RefTitle agammaglobulinemia RefLoc Hum. Molec. Genet. 3:1743-1749(1994) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_44 DB CrossRef SWISS-PROT; Q06187:520_520 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65416 Feature /change: g -> a Feature /CpG; 2 Feature /genomic_region: exon; 15 Feature /RE: +AccB7I, +PflMI, +Van91I, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1691 Feature /codon: cga -> caa; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 520 Feature /change: R -> Q Feature /domain: TK Protein struct affects phosphotyrosine binding; ref [2] Symptoms classical XLA Sex XY Family history inherited IgA nd IgE nd IgG nd IgM nd B cells surf Ig nd // ID BTK_HUMAN; ;R520Q; RQ Occurrence 1/1 Accession K141 DBCrossRef BTKbase:A0196 Original code 50 Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 25-Sep-1995 (Rel. 2, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95152493 RefAuthors Hagemann, T. L., Chen, Y., Rosen, F. S., Kwan, S. RefTitle Genomic organization of the Btk gene and exon scanning for RefTitle mutations in the patients with X-linked RefTitle agammaglobulinemia RefLoc Hum. Molec. Genet. 3:1743-1749(1994) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_44 DB CrossRef SWISS-PROT; Q06187:520_520 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65416 Feature /change: g -> a Feature /CpG; 2 Feature /genomic_region: exon; 15 Feature /RE: +AccB7I, +PflMI, +Van91I, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1691 Feature /codon: cga -> caa; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 520 Feature /change: R -> Q Feature /domain: TK Protein struct affects phosphotyrosine binding; ref [2] Symptoms classical XLA Sex XY Family history inherited IgA nd IgE nd IgG nd IgM nd B cells surf Ig nd // ID BTK_HUMAN; ;R520Q; RQ Occurrence 1/1 Accession K142 DBCrossRef BTKbase:A0290 Original code N19; TP Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 15-May-1996 (Rel. 3, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (15-May-1996) to the BTKbase RefLoc Dr. Jerrold. H. Schwaber, Hahnemann University, Broad & RefLoc Wine Philadelphia, PA 19102, USA, RefLoc e-mail schwaberj@hal.hahnemann.edu. RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_44 DB CrossRef SWISS-PROT; Q06187:520_520 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65416 Feature /change: g -> a Feature /CpG; 2 Feature /genomic_region: exon; 15 Feature /RE: +AccB7I, +PflMI, +Van91I, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1691 Feature /codon: cga -> caa; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 520 Feature /change: R -> Q Feature /domain: TK Protein struct affects phosphotyrosine binding; ref [2] Symptoms classical XLA Sex XY Age 0.75 Family history inherited IgG 20 IgM < 50 B cells surf Ig <1 Comment -!-Family history: affected twin brother and an uncle // ID BTK_HUMAN; ;R520Q; RQ Occurrence 1/1 Accession K143 DBCrossRef BTKbase:A0435 Original code G14247 Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 07-Sep-1997 (Rel. 5, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (07-Sep-1997) to the BTKbase. RefLoc Dr. Tracy Lester, Unit of Clinical Genetics, Institute RefLoc of Child Health, 30 Guilford Street, London, WC1N 1EH, RefLoc Tel 0171 242 9789 ext 2284, Fax 0171 404 6191 RefLoc e-mail T.Lester@ich.ucl.ac.uk RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_44 DB CrossRef SWISS-PROT; Q06187:520_520 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65416 Feature /change: g -> a Feature /CpG; 2 Feature /genomic_region: exon; 15 Feature /RE: +AccB7I, +PflMI, +Van91I, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1691 Feature /note: generates PflMI site Feature /codon: cga -> caa; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 520 Feature /change: R -> Q Feature /domain: TK Protein struct affects phosphotyrosine binding; ref [2] Symptoms classical XLA Sex XY Ethnic origin Caucasoid; Scotland Family history inherited Comment -!-General: no detectable B cells or Ig // ID BTK_HUMAN; ;R520Q; RQ Occurrence 1/1 Accession K144 DBCrossRef BTKbase:A0436 Original code G16115 Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 07-Sep-1997 (Rel. 5, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (07-Sep-1997) to the BTKbase. RefLoc Dr. Tracy Lester, Unit of Clinical Genetics, Institute RefLoc of Child Health, 30 Guilford Street, London, WC1N 1EH, RefLoc Tel 0171 242 9789 ext 2284, Fax 0171 404 6191 RefLoc e-mail T.Lester@ich.ucl.ac.uk RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_44 DB CrossRef SWISS-PROT; Q06187:520_520 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65416 Feature /change: g -> a Feature /CpG; 2 Feature /genomic_region: exon; 15 Feature /RE: +AccB7I, +PflMI, +Van91I, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1691 Feature /note: generates PflMI site Feature /codon: cga -> caa; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 520 Feature /change: R -> Q Feature /domain: TK Protein struct affects phosphotyrosine binding; ref [2] Symptoms classical XLA Sex XY Ethnic origin Caucasoid; UK Family history inherited // ID BTK_HUMAN; ;R520Q; RQ Occurrence 1/1 Accession K145 DBCrossRef BTKbase:A0521 Original code G16115 Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 15-Oct-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (15-Oct-1998) to BTKbase. RefLoc Dr. Tracy Lester, Clinical Molecular Genetics Laboratory, RefLoc Level 5, Camelia Botnar Laboratories, Great Ormond Street RefLoc Hospital for Children NHS Trust, Great Ormond Street, RefLoc London, WC1N 3JH, RefLoc e-mail tracy.lester@gosh-tr.nthames.nhs.uk DB CrossRef SWISSCHANGE; BTK_HUMAN_44 DB CrossRef SWISS-PROT; Q06187:520_520 Feature dna; 1 Feature /rnalink; 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65416 Feature /change: g -> a Feature /CpG; 2 Feature /genomic_region: exon;15 Feature /RE: +AccB7I, +PflMI, +Van91I, Feature rna; 2 Feature /dnalink; 1 Feature /aalink; 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1691 Feature /codon: cga -> caa; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: substitution Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 520 Feature /change: R -> Q Feature /domain: TK Symptoms classical XLA Sex XY Ethnic origin - ; UK // ID BTK_HUMAN; ;D521G; DG Occurrence 1/1 Accession K146 DBCrossRef BTKbase:A0398 Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 15-May-1997 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 3) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (27-Aug-1996) to the BTKbase. RefLoc Dr. Michael Weiss, prof. Dr. Bernd H. Belohradsky, RefLoc Abteilung fur Infektionsimmunologia, Dr. von Haunersches RefLoc Kinderspital Klinikum Innenstadt der Universitat, Munchen, RefLoc Lindwurmstrasse 4, D-80337 Munchen, Germany, RefLoc FAX 498 951 604 928. RefLoc Dr. Elke Holinski-Feder, Dr. Alfons Meindl, Abteilung fur RefLoc Padiatrische Genetik Kinderpoliklinik, Klinikum Innenstadt RefLoc der Universitat, Munchen, Goethestrasse 29, D-80336 RefLoc Munchen, Germany. RefNumber [2] RefCrossRef MEDLINE; 98118357 RefAuthors Holinski-Feder, E., Weiss M., Brandau, O., Jedele, K. B., RefAuthors Nore, B., Beckesj", C.-M., Vihinen, M., G"tz, G., Hubbard, RefAuthors S. R., Belohradsky, B. H., Smith, C. I. E., Meindl, A. RefTitle Mutation screening of the btk gene in 56 families with RefTitle X-linked agammaglobulinemia (XLA) - 47 unique mutations RefTitle without correlation to clinical course RefLoc Pediatrics 101:276-284(1998) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65419 Feature /change: a -> g Feature /genomic_region: exon; 15 Feature /RE: +AatI, +BsaJI, +BseDI, +BshI, +BshI, -BshI, Feature /RE: -BshI, +BssECI, +BsuRI, +BsuRI, -BsuRI, -BsuRI, Feature /RE: +CviJI, +CviJI, -CviJI, -CviJI, +Eco147I, +HaeI, Feature /RE: +HaeI, -HaeI, -HaeI, +HaeIII, +HaeIII, -HaeIII, Feature /RE: -HaeIII, +PalI, +PalI, -PalI, -PalI, +Pme55I, Feature /RE: +SecI, +SseBI, +StuI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1694 Feature /codon: gac -> ggc; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 521 Feature /change: D -> G Feature /domain: TK Sex XY // ID BTK_HUMAN; ;D521H; DH Occurrence 1/1 Accession K147 DBCrossRef BTKbase:A0315 Original code P17 Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 14-Aug-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 3) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 96289505 RefAuthors Hashimoto, S., Tsukada, S., Matsushita, M., Miyawaki, T., RefAuthors Niida, Y., Yachie, A., Kobayashi, S., Iwata, T., RefAuthors Hayakawa, H., Matsuoka, H., Tsuge, I., Yamadori, T., RefAuthors Kunikata, T., Arai, S., Yoshizaki, K., Taniguchi, N., RefAuthors Kishimoto, T. RefTitle Identification of Bruton's tyrosine kinase (Btk) gene RefTitle mutations and characterization of the derived proteins in RefTitle 35 X-linked agammaglobulinemia families: a nationwide RefTitle study of Btk deficiency in Japan RefLoc Blood 88:561-573(1996) RefNumber [2] RefCrossRef MEDLINE; 98102441 RefAuthors Futatani, T., Miyawaki, T., Tsukada, S., Hashimoto, S., RefAuthors Kunikata, T., Arai, S., Kurimoto, T., Niida, Y., Matsuoka, RefAuthors H., Sakiyama, Y., Iwata, T., Tsuchiya, S., Tatsuzawa, O., RefAuthors Yoshizaki, K., Kishimoto, T. RefTitle Deficient expression of Bruton's tyrosine kinase in RefTitle monocytes from X-linked agammaglobulinemia as evaulated by RefTitle a flow cytometric analysis and its clinical application to RefTitle carrier detection RefLoc Blood 91:595-602(1998) DB CrossRef SWISSCHANGE; BTK_HUMAN_45 DB CrossRef SWISS-PROT; Q06187:521_521 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65418 Feature /change: g -> c Feature /genomic_region: exon; 15 Feature /RE: +AdeI, +Bsp24I, +CjeI, +DraIII, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1693 Feature /codon: gac -> cac; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 521 Feature /change: D -> H Feature /domain: TK Protein level normal; ref [2] Kinase activity inactive Sex XY Age 0.67 Ethnic origin Mongoloid; Japan Family history inherited IgA < 0.08 IgG 0.36 IgM 0.08 B cells surf Ig 0 // ID BTK_HUMAN; ;D521N; DN Occurrence 1/1 Accession K148 DBCrossRef BTKbase:A0199 Original code KG Description missense mutation in the exon 15 leading to Description amino acid change in TK domain Date 25-Sep-1995 (Rel. 2, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (08-Sept-1995) to the BTKbase. RefLoc Dr. Hans D. Ochs, Dept of Pediatrics, University of RefLoc Washington, Seattle, WA 98195, USA, RefLoc e-mail allgau@u.washington.edu. RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_46 DB CrossRef SWISS-PROT; Q06187:521_521 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65418 Feature /change: g -> a Feature /genomic_region: exon; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1693 Feature /codon: gac -> aac; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 521 Feature /change: D -> N Feature /domain: TK Protein struct disturbs catalysis; ref [2] Symptoms classical XLA Sex XY Family history inherited // ID BTK_HUMAN; ;#A523-114; GLRLYRPHLASEKVYTIMYSCWHE Occurrence 1/1 Accession K149 DBCrossRef BTKbase:A0317 Original code P9 Description inframe deletion of exons 16-18 in TK domain Date 19-Aug-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 3) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 96289505 RefAuthors Hashimoto, S., Tsukada, S., Matsushita, M., Miyawaki, T., RefAuthors Niida, Y., Yachie, A., Kobayashi, S., Iwata, T., RefAuthors Hayakawa, H., Matsuoka, H., Tsuge, I., Yamadori, T., RefAuthors Kunikata, T., Arai, S., Yoshizaki, K., Taniguchi, N., RefAuthors Kishimoto, T. RefTitle Identification of Bruton's tyrosine kinase (Btk) gene RefTitle mutations and characterization of the derived proteins in RefTitle 35 X-linked agammaglobulinemia families: a nationwide RefTitle study of Btk deficiency in Japan RefLoc Blood 88:561-573(1996) RefNumber [2] RefCrossRef MEDLINE; 98102441 RefAuthors Futatani, T., Miyawaki, T., Tsukada, S., Hashimoto, S., RefAuthors Kunikata, T., Arai, S., Kurimoto, T., Niida, Y., Matsuoka, RefAuthors H., Sakiyama, Y., Iwata, T., Tsuchiya, S., Tatsuzawa, O., RefAuthors Yoshizaki, K., Kishimoto, T. RefTitle Deficient expression of Bruton's tyrosine kinase in RefTitle monocytes from X-linked agammaglobulinemia as evaulated by RefTitle a flow cytometric analysis and its clinical application to RefTitle carrier detection RefLoc Blood 91:595-602(1998) Feature dna; 1 Feature /rnalink: 2 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 66781..68282 Feature /change: -gcagctcgaa actgtttggt aaacgatcaa ggagttgtta Feature /change: aagtatctga tttcggcctg tccaggtatg tcctggatga Feature /change: tgaatacaca agctcagtag gctccaaatt tccagtccgg Feature /change: tggtccccac cggaagtcct gatgtatagc aagttcagca Feature /change: gcaaatctga catttgggct tttggggttt tgatgtggga Feature /change: aatttactcc ctggggaaga tgccatatga gagatttact Feature /change: aacagtgaga ctgctgaaca cattgcccaa ggcctacgtc Feature /change: tctacaggcc tcatctggct tcagagaagg tatataccat Feature /change: catgtacagt tgttggcatg ag Feature /genomic_region: exon; 16..18 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: inframe_deletion Feature /loc:EMBL: X58957; G312467; HSATK: 1699..2040 Feature aa; 3 Feature /rnalink: 2 Feature /name: Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 523..636 Feature /change: -AARNCLVNDQ GVVKVSDFGL SRYVLDDEYT Feature /change: SSVGSKFPVR WSPPEVLMYS KFSSKSDIWA Feature /change: FGVLMWEIYS LGKMPYERFT NSETAEHIAQ Feature /change: GLRLYRPHLA SEKVYTIMYS CWHE Feature /domain: TK Protein level absent; ref [2] Kinase activity inactive; ref [2] Sex XY Age 0.5 Ethnic origin Mongoloid; Japan Family history inherited IgA < 0.05 IgM < 0.05 B cells surf Ig 0 Comment -!-Symptoms: agranulocytosis // ID BTK_HUMAN; ;A523E; AE Occurrence 1/1 Accession K150 DBCrossRef BTKbase:A0522 Original code G9251 Description point mutation in the exon 16 causing amino acid Description change in domain TK Date 28-Oct-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (15-Oct-1998) to BTKbase. RefLoc Dr. Tracy Lester, Clinical Molecular Genetics Laboratory, RefLoc Level 5, Camelia Botnar Laboratories, Great Ormond Street RefLoc Hospital for Children NHS Trust, Great Ormond Street, RefLoc London, WC1N 3JH, RefLoc e-mail tracy.lester@gosh-tr.nthames.nhs.uk Feature dna; 1 Feature /rnalink; 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 66782 Feature /change: c -> a Feature /genomic_region: exon;16 Feature rna; 2 Feature /dnalink; 1 Feature /aalink; 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1700 Feature /codon: gca -> gaa; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: substitution Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 523 Feature /change: A -> E Feature /domain: TK Ethnic origin - ; United Kingdom // ID BTK_HUMAN; ;R525X; RX Occurrence 1/1 Accession K151 DBCrossRef BTKbase:A0118 Original code 32/21 Description nonsense mutation in the exon 16 leading to Description stop codon in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95227177 RefAuthors Vorechovsky, I., Vihinen, M., de Saint Basile, G., RefAuthors Honsova, S., Hammarstrom, L., Muller, S., Nilsson, L., RefAuthors Fischer, A., Smith, C. I. E. RefTitle DNA-based mutation analysis of Bruton's tyrosine gene RefTitle in patients with X-linked agammaglobulinemia RefLoc Hum. Molec. Genet. 4:51-58(1995) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 66787 Feature /change: c -> t Feature /CpG; 1 Feature /genomic_region: exon; 16 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1705 Feature /codon: cga -> tga; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 525 Feature /change: R -> X Feature /domain: TK Protein struct premature stop Sex XY Family history inherited // ID BTK_HUMAN; ;R525X; RX Occurrence 1/1 Accession K152 DBCrossRef BTKbase:A0338 Original code FP Description nonsense mutation in the exon 16 leading to Description stop codon in TK domain Date 27-Aug-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (27-Aug-1996) to the BTKbase. RefLoc Dr. Michael Weiss, prof. Dr. Bernd H. Belohradsky, RefLoc Abteilung fur Infektionsimmunologia, Dr. von Haunersches RefLoc Kinderspital Klinikum Innenstadt der Universitat, Munchen, RefLoc Lindwurmstrasse 4, D-80337 Munchen, Germany, RefLoc FAX 498 951 604 928. RefLoc Dr. Elke Holinski-Feder, Dr. Alfons Meindl, Abteilung fur RefLoc Padiatrische Genetik Kinderpoliklinik, Klinikum Innenstadt RefLoc der Universitat, Munchen, Goethestrasse 29, D-80336 RefLoc Munchen, Germany. RefNumber [2] RefCrossRef MEDLINE; 98118357 RefAuthors Holinski-Feder, E., Weiss M., Brandau, O., Jedele, K. B., RefAuthors Nore, B., Beckesj", C.-M., Vihinen, M., G"tz, G., Hubbard, RefAuthors S. R., Belohradsky, B. H., Smith, C. I. E., Meindl, A. RefTitle Mutation screening of the btk gene in 56 families with RefTitle X-linked agammaglobulinemia (XLA) - 47 unique mutations RefTitle without correlation to clinical course RefLoc Pediatrics 101:276-284(1998) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 66787 Feature /change: c -> t Feature /CpG; 1 Feature /genomic_region: exon; 16 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1705 Feature /codon: cga -> tga; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 525 Feature /change: R -> X Feature /domain: TK Symptoms classical XLA Sex XY Age 4 IgA 0.01 IgG 2.02 IgM 0.20 CD19 1 Comment -!-Symptoms: airway infections, H. influenzaearthritis // ID BTK_HUMAN; ;R525X; RX Occurrence 1/1 Accession K153 DBCrossRef BTKbase:A0402 Original code G Description nonsense mutation in the exon 16 leading to Description stop codon in TK domain Date 02-Jan-1997 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (01-Jan-1997) to the BTKbase. RefLoc Dr. C.I.E. Smith, Center for BioTechnology, Department of RefLoc Biosciences at Novum, Karolinska Institute, S-14157 RefLoc Huddinge, Sweden, e-mail edvard.smith@cbt.ki.se Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 66787 Feature /change: c -> t Feature /CpG; 1 Feature /genomic_region: exon; 16 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1705 Feature /codon: cga -> tga; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 525 Feature /change: R -> X Feature /domain: TK Sex XY // ID BTK_HUMAN; ;R525X; RX Occurrence 1/1 Accession K154 DBCrossRef BTKbase:A0523 Original code G13840 Description nonsense mutation in the exon 16 leading to Description stop codon in TK domain Date 15-Oct-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (15-Oct-1998) to BTKbase. RefLoc Dr. Tracy Lester, Clinical Molecular Genetics Laboratory, RefLoc Level 5, Camelia Botnar Laboratories, Great Ormond Street RefLoc Hospital for Children NHS Trust, Great Ormond Street, RefLoc London, WC1N 3JH, RefLoc e-mail tracy.lester@gosh-tr.nthames.nhs.uk Feature dna; 1 Feature /rnalink; 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 66787 Feature /change: c -> t Feature /CpG; 1 Feature /genomic_region: exon;16 Feature rna; 2 Feature /dnalink; 1 Feature /aalink; 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1705 Feature /codon: cga -> tga; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 525 Feature /change: R -> X Feature /domain: TK Protein level absent Symptoms classical XLA Sex XY Age 3 Family history inherited Ethnic origin - ; Falklands Comment -!-Symptoms: persistent chest infections, juvenile Comment rheumatoid arthritis Comment -!-General: no visible gamma globulin on Comment electrophoresis // ID BTK_HUMAN; ;R525G; RG Occurrence 1/1 Accession K155 DBCrossRef BTKbase:A0500 Original code 1750 Description point in the exon 16 causing amino acid change Description in domain TK Date 28-Apr-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 98213565 RefAuthors Conley, M. E., Mathias, D., Treadaway, J., Minegishi, RefAuthors Y., Rohrer, J. RefTitle Mutations in Btk patients with presumed X-linked RefTitle agammaglobulinemia RefLoc Am J. Hum. Genet. 62:1034-1043(1998) Feature dna; 1 Feature /rnalink; 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 66787 Feature /change: c -> g Feature /CpG; 1 Feature /genomic_region: exon;16 Feature /RE: +MspA1I, +NspBII, +PvuII, Feature rna; 2 Feature /dnalink; 1 Feature /aalink; 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1705 Feature /codon: cga -> gga; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: substitution Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 525 Feature /change: R -> G Feature /domain: TK Symptoms classical XLA Sex XY Family history inherited // ID BTK_HUMAN; ;R525P; RP Occurrence 1/1 Accession K156 DBCrossRef BTKbase:A0119 Original code 15/20 Description missense mutation in the exon 16 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95227177 RefAuthors Vorechovsky, I., Vihinen, M., de Saint Basile, G., RefAuthors Honsova, S., Hammarstrom, L., Muller, S., Nilsson, L., RefAuthors Fischer, A., Smith, C. I. E. RefTitle DNA-based mutation analysis of Bruton's tyrosine gene RefTitle in patients with X-linked agammaglobulinemia RefLoc Hum. Molec. Genet. 4:51-58(1995) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_47 DB CrossRef SWISS-PROT; Q06187:525_525 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 66788 Feature /change: g -> c Feature /genomic_region: exon; 16 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1706 Feature /codon: cga -> cca; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 525 Feature /change: R -> P Feature /domain: TK Protein struct distortion of catalytic site; ref [2] Sex XY Family history inherited // ID BTK_HUMAN; ;R525Q; RQ Occurrence 2/2 Accession K157 DBCrossRef BTKbase:A0001 Original code A Description missense mutation in the exon 16 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 93140868 RefAuthors Vetrie, D., Vorechovsky, I., Sideras, P. Holland, J., RefAuthors Davies, A., Flinter, F., Hammarstrom, L. Kinnon, C., RefAuthors Levinsky, R., Robrow, M., Smith, C.I.E, Bentley, D.R. RefTitle The gene involved in X-linked agammaglobulinemia is RefTitle a member of the src family of protein-tyrosine kinases RefLoc Nature 361:226-233(1993) RefNumber [2] RefCrossRef MEDLINE; 94110610 RefAuthors Smith, C. I. E., Baskin, B., Humire-Greiff, P., Zhou RefAuthors J. N., Olsson, P. G., Maniar, H. S., Kjellen, P., RefAuthors Lambris, J. d., Christensson, B., Hammarstrom, L., Bentley, RefAuthors D., Vetrie, D., Islam, K. B., Vorechovsky, I., Sideras, P. RefTitle Expression of Bruton's agammaglobulinemia tyrosine kinase RefTitle gene, BTK, is selectively down-regulated in the T- RefTitle lymphocytes and plasma cells RefLoc J. Immunol. 152:557-565(1994) RefNumber [3] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef ESID; SE 0542 M78 G1 DB CrossRef OMIM; 300300.0001 DB CrossRef SWISSCHANGE; BTK_HUMAN_48 DB CrossRef SWISS-PROT; Q06187:525_525 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 66788 Feature /change: g -> a Feature /CpG; 2 Feature /genomic_region: exon; 16 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1706 Feature /note: destroys TaqI site Feature /codon: cga -> caa; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 525 Feature /change: R -> Q Feature /domain: TK mRNA level normal Protein level normal Kinase activity inactive Protein struct distortion of catalytic site; ref [3] Symptoms classical XLA Sex XY Ethnic origin Caucasoid; Sweden Family history inherited Relative BTK; A0002; maternal CD19 0.2 CD20 0.5 // ID BTK_HUMAN; ;R525Q; RQ Occurrence 3/3 Accession K159 DBCrossRef BTKbase:A0034 Original code P08 Description missense mutation in the exon 16 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 94377492 RefAuthors Ohta, Y., Haire, R. N., Litman, R. T., Shu, M. F., Nelson, RefAuthors R. P., Kratz, J., Kornfeld, S. J., De La Morena, M., Good, RefAuthors R. A., Litman, G. W. RefTitle Genomic organization and structure of Bruton RefTitle agammaglobulinemia tyrosine kinase: Localization of RefTitle mutations associated with varied clinical presentations RefTitle and cource in X chromosome-linked agammaglobulinemia RefLoc Proc. Natl. Acad. Sci. 91:9062-9066(1994) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef OMIM; 300300.0001 DB CrossRef SWISSCHANGE; BTK_HUMAN_48 DB CrossRef SWISS-PROT; Q06187:525_525 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 66788 Feature /change: g -> a Feature /CpG; 2 Feature /genomic_region: exon; 16 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1706 Feature /codon: cga -> caa; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 525 Feature /change: R -> Q Feature /domain: TK Protein struct distortion of catalytic site; ref [2] Symptoms moderate XLA Sex XY Age 8 Family history inherited Relative BTK; A0035; cousin Relative BTK; A0036; cousin IgA 0.06 IgG 1.00 IgM 5.0 CD20 <1 Comment -!-Family history: 3 affected cousins Comment -!-Symptoms: otitis media, URI, pulmonary // ID BTK_HUMAN; ;R525Q; RQ Occurrence 4/4 Accession K162 DBCrossRef BTKbase:A0049 Original code @V377X404(1a) Description missense mutation in the exon 16 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95152522 RefAuthors Zhu, Q., Zhang, M., Winkelstein, J., Chen., S., Ochs, H.D. RefTitle Unique mutations of Bruton's tyrosine kinase in fourteen RefTitle unrelated X-linked agammaglobulinemia families RefLoc Hum. Molec. Genet. 3:1899-1900(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_48 DB CrossRef SWISS-PROT; Q06187:525_525 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 66788 Feature /change: g -> a Feature /CpG; 2 Feature /genomic_region: exon; 16 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1706 Feature /codon: cga -> caa; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 525 Feature /change: R -> Q Feature /domain: TK Protein struct distortion of catalytic site; ref [2] Symptoms moderate XLA Sex XY Relative BTK; A0050 Relative BTK; A0051 Relative BTK; A0052 // ID BTK_HUMAN; ;R525Q; RQ Occurrence 1/1 Accession K166 DBCrossRef BTKbase:A0384 Description missense mutation in the exon 16 leading to Description amino acid change in TK domain Date 15-May-1997 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (27-Aug-1996) to the BTKbase. RefLoc Dr. Michael Weiss, prof. Dr. Bernd H. Belohradsky, RefLoc Abteilung fur Infektionsimmunologia, Dr. von Haunersches RefLoc Kinderspital Klinikum Innenstadt der Universitat, Munchen, RefLoc Lindwurmstrasse 4, D-80337 Munchen, Germany, RefLoc FAX 498 951 604 928. RefLoc Dr. Elke Holinski-Feder, Dr. Alfons Meindl, Abteilung fur RefLoc Padiatrische Genetik Kinderpoliklinik, Klinikum Innenstadt RefLoc der Universitat, Munchen, Goethestrasse 29, D-80336 RefLoc Munchen, Germany. RefNumber [2] RefCrossRef MEDLINE; 98118357 RefAuthors Holinski-Feder, E., Weiss M., Brandau, O., Jedele, K. B., RefAuthors Nore, B., Beckesj", C.-M., Vihinen, M., G"tz, G., Hubbard, RefAuthors S. R., Belohradsky, B. H., Smith, C. I. E., Meindl, A. RefTitle Mutation screening of the btk gene in 56 families with RefTitle X-linked agammaglobulinemia (XLA) - 47 unique mutations RefTitle without correlation to clinical course RefLoc Pediatrics 101:276-284(1998) RefNumber [3] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_48 DB CrossRef SWISS-PROT; Q06187:525_525 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 66788 Feature /change: g -> a Feature /CpG; 2 Feature /genomic_region: exon; 16 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1706 Feature /codon: cga -> caa; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 525 Feature /change: R -> Q Feature /domain: TK Protein struct distortion of catalytic site; ref [3] Sex XY // ID BTK_HUMAN; ;N526K; NK Occurrence 1/1 Accession K167 DBCrossRef BTKbase:A0120 Original code 2/19 Description missense mutation in the exon 16 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95227177 RefAuthors Vorechovsky, I., Vihinen, M., de Saint Basile, G., RefAuthors Honsova, S., Hammarstrom, L., Muller, S., Nilsson, L., RefAuthors Fischer, A., Smith, C. I. E. RefTitle DNA-based mutation analysis of Bruton's tyrosine gene RefTitle in patients with X-linked agammaglobulinemia RefLoc Hum. Molec. Genet. 4:51-58(1995) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_49 DB CrossRef SWISS-PROT; Q06187:526_526 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 66792 Feature /change: c -> g Feature /genomic_region: exon; 16 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1710 Feature /codon: aac -> aag; 3 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 526 Feature /change: N -> K Feature /domain: TK Protein struct disturbs Mg and D521 binding; ref [2] Sex XY Family history inherited // ID BTK_HUMAN; ;@S572X; SX Occurrence 1/1 Accession K168 DBCrossRef BTKbase:A0525 Original code G15917 Description frameshift insertion in the exon 17 leading to Description stop codon in TK domain Date 16-Oct-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (16-Oct-1998) to BTKbase. RefLoc Dr. Tracy Lester, Clinical Molecular Genetics Laboratory, RefLoc Level 5, Camelia Botnar Laboratories, Great Ormond Street RefLoc Hospital for Children NHS Trust, Great Ormond Street, RefLoc London, WC1N 3JH, RefLoc e-mail tracy.lester@gosh-tr.nthames.nhs.uk Feature dna; 1 Feature /rnalink; 2 Feature /name: insertion Feature /loc: EMBL: Hsu78027: 67569 Feature /change: +ta Feature /genomic_region: exon;17 Feature /RE: +BbvI, +Bst71I, +Fnu4HI, +Fsp4HI, +Hpy188IX, +ItaI, Feature /RE: +MseI, +MwoI, +Tru1I, +Tru9I, +TseI, Feature rna; 2 Feature /dnalink; 1 Feature /aalink; 3 Feature /name: frameshift Feature /loc: EMBL: X58957; G312467; HSATK: 1846 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 572 Feature /change: S -> X Feature /domain: TK Symptoms classical XLA Sex XY Age 0.92 Family history inherited Ethnic origin - ; Spain IgA 0.020 IgG 0.175 IgM 0.010 CD19 0 Comment -!-Symptoms: Septicaemia // ID BTK_HUMAN; ;#C527X528; CWX Occurrence 1/1 Accession K169 DBCrossRef BTKbase:A0037 Original code P17 Description frameshift deletion in the exon 16 leading to stop codon in Description TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 94377492 RefAuthors Ohta, Y., Haire, R. N., Litman, R. T., Shu, M. F., Nelson, RefAuthors R. P., Kratz, J., Kornfeld, S. J., De La Morena, M., Good, RefAuthors R. A., Litman, G. W. RefTitle Genomic organization and structure of Bruton RefTitle agammaglobulinemia tyrosine kinase: Localization of RefTitle mutations associated with varied clinical presentations and RefTitle cource in X chromosome-linked agammaglobulinemia RefLoc Proc. Natl. Acad. Sci. 91:9062-9066(1994) Feature dna; 1 Feature /rnalink: 2 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 66795..66798 Feature /change: -tttg or -gttt Feature /genomic_region: exon; 16 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: frameshift Feature /loc:EMBL: X58957; G312467; HSATK: 1713..1716 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 527 Feature /change: C -> WX Feature /domain: TK Protein struct premature stop Symptoms classical XLA Sex XY Age 1.4 Family history inherited IgA < 2.5 IgG nd IgM 40 CD20 <1 Comment -!-Symptoms: pneumonia, Pseudomonas, Staphylococcus aureus // ID BTK_HUMAN; ;#C527X528; CWX Occurrence 1/1 Accession K170 DBCrossRef BTKbase:A0094 Original code P18, A0258 Description frameshift deletion in the exon 16 leading to stop codon in Description TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95152494 RefAuthors Conley, M. E., Fitch-Hilgenberg, M. E., Cleveland, J. L. RefAuthors Parolini, O., Rohrer, J. RefTitle Screening of genomic DNA to indentify mutations in the RefTitle gene for Bruton's tyrosine kinase RefLoc Hum. Molec. Genet. 3: 1751-1756(1994) RefNumber [2] RefCrossRef MEDLINE; 96007207 RefAuthors Conley, M. E., Rohrer, J. RefTitle The spectrum of mutations in Btk that cause X-linked RefTitle agammaglobulinemia RefLoc Clin. Immunol. Immunopathol. 76:S192-S197(1995) DB CrossRef OMIM; 300300.0039 Feature dna; 1 Feature /rnalink: 2 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 66795..66798 Feature /change: -tttg or - gttt Feature /genomic_region: exon; 16 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: frameshift Feature /loc:EMBL: X58957; G312467; HSATK: 1713..1716 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 527 Feature /change: C -> WX Feature /domain: TK Protein struct premature stop Sex XY Family history de novo // ID BTK_HUMAN; ;#C527X528; CWX Occurrence 1/1 Accession K171 DBCrossRef BTKbase:A0200 Original code JC Description frameshift deletion in the exon 16 leading to stop codon in Description TK domain Date 25-Sep-1995 (Rel. 2, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (08-Sept-1995) to the BTKbase. RefLoc Dr. Hans D. Ochs, Dept of Pediatrics, University of RefLoc Washington, Seattle, WA 98195, USA, RefLoc e-mail allgau@u.washington.edu. Feature dna; 1 Feature /rnalink: 2 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 66795..66798 Feature /change: -tttg or -gttt Feature /genomic_region: exon; 16 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: frameshift Feature /loc:EMBL: X58957; G312467; HSATK: 1713..1716 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 527 Feature /change: C -> WX Feature /domain: TK Protein struct premature stop Symptoms classical XLA Sex XY Family history inherited // ID BTK_HUMAN; ;#N530X555; NTIKELLKYKISACPGMSWMMNTQAQX Occurrence 1/1 Accession K172 DBCrossRef BTKbase:A0074 Original code 30 Description frameshift deletion in the exon 16 leading to Description stop codon in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95152493 RefAuthors Hagemann, T. L., Chen, Y., Rosen, F. S., Kwan, S. RefTitle Genomic organization of the Btk gene and exon scanning for RefTitle mutations in the patients with X-linked RefTitle agammaglobulinemia RefLoc Hum. Molec. Genet. 3:1743-1749(1994) DB CrossRef OMIM; 300300.0038 Feature dna; 1 Feature /rnalink: 2 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 66802 Feature /change: -a Feature /genomic_region: exon; 16 Feature /RE: +MaeIII, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: frameshift Feature /loc:EMBL: X58957; G312467; HSATK: 1720 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 530..555 Feature /change: N -> TIKELLKYKI SACPGMSWMM NTQAQX Feature /domain: TK Protein struct premature stop Symptoms classical XLA Sex XY Family history inherited IgA hd IgE hd IgG < 10% IgM hd B cells surf Ig nd // ID BTK_HUMAN; ;#G533X555; GELLKYLISACPGMSWMMNTQAQ* Occurrence 1/1 Accession K173 DBCrossRef BTKbase:A0501 Original code 1830 Description deletion in the exon 16 Date 28-Apr-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 98213565 RefAuthors Conley, M. E., Mathias, D., Treadaway, J., Minegishi, RefAuthors Y., Rohrer, J. RefTitle Mutations in Btk patients with presumed X-linked RefTitle agammaglobulinemia RefLoc Am J. Hum. Genet. 62:1034-1043(1998) Feature dna; 1 Feature /rnalink; 2 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 66811 Feature /change: g -> Feature /genomic_region: exon;16 Feature rna; 2 Feature /dnalink; 1 Feature /aalink; 3 Feature /name: frameshift Feature /loc: EMBL: X58957; G312467; HSATK: 1729 Feature /codon: gga -> -; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: out-of-frame extension Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 533 Feature /change: G -> ELLKYLISACPGMSWMMNTQAQ* Feature /domain: TK Symptoms classical XLA Sex XY Family history de novo // ID BTK_HUMAN; ;V535F; VF Occurrence 1/1 Accession K174 DBCrossRef BTKbase:A0502 Original code 1850 Description point in the exon 16 causing amino acid change Description in domain TK Date 28-Apr-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 98213565 RefAuthors Conley, M. E., Mathias, D., Treadaway, J., Minegishi, RefAuthors Y., Rohrer, J. RefTitle Mutations in Btk patients with presumed X-linked RefTitle agammaglobulinemia RefLoc Am J. Hum. Genet. 62:1034-1043(1998) Feature dna; 1 Feature /rnalink; 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 66817 Feature /change: g -> t Feature /genomic_region: exon;16 Feature /RE: +AhaIII, +DraI, Feature rna; 2 Feature /dnalink; 1 Feature /aalink; 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1735 Feature /codon: gtt -> ttt; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: substitution Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 535 Feature /change: V -> F Feature /domain: TK Symptoms classical XLA Sex XY Family history inherited // ID BTK_HUMAN; ;L542P; LP Occurrence 1/1 Accession K175 DBCrossRef BTKbase:A0095 Original code 19 Description missense mutation in the exon 16 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95152494 RefAuthors Conley, M. E., Fitch-Hilgenberg, M. E., Cleveland, J. L. RefAuthors Parolini, O., Rohrer, J. RefTitle Screening of genomic DNA to indentify mutations in the RefTitle gene for Bruton's tyrosine kinase RefLoc Hum. Molec. Genet. 3: 1751-1756(1994) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef OMIM; 300300.0040 DB CrossRef SWISSCHANGE; BTK_HUMAN_50 DB CrossRef SWISS-PROT; Q06187:542_542 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 66839 Feature /change: t -> c Feature /genomic_region: exon; 16 Feature /RE: +AspS9I, +AsuI, +BscGI, +BsiZI, +Cfr13I, +Sau96I, Feature /RE: +Sth132I, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1757 Feature /codon: ctg -> ccg; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 542 Feature /change: L -> P Feature /domain: TK Protein struct substrate binding; ref [2] Sex XY Family history inherited B cells surf Ig <1 Comment -!-Symptoms: growth hormone deficiency // ID BTK_HUMAN; ;R544K; RK Occurrence 1/1 Accession K176 DBCrossRef BTKbase:A0218 Original code P16 Description missense mutation in the exon 16 leading to Description amino acid change in TK domain Date 26-Sep-1995 (Rel. 3, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 96431154 RefAuthors Kobayashi, S., Iwata, T., Saito, M., Iwasaki, R., RefAuthors Matsumoto, H., Naritaka, S., Kono, Y., Hayashi, Y. RefTitle Mutations of the Btk gene in 12 unrelated families RefTitle with X-linked agammaglobulinemia in Japan RefLoc Hum. Genet. 97:424-430(1996) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_51 DB CrossRef SWISS-PROT; Q06187:544_544 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 66845 Feature /change: g -> a Feature /genomic_region: exon; 16 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1763 Feature /codon: agg -> aag; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 544 Feature /change: R -> K Feature /domain: TK Protein struct affects phosphotyrosine binding; ref [2] Symptoms classical XLA Sex XY Family history inherited IgA < 0.05 IgG 0.30 IgM < 0.05 // ID BTK_HUMAN; ;S554X; SX Occurrence 1/1 Accession K177 DBCrossRef BTKbase:A0339 Original code SA Description nonsense mutation in the exon 17 leading to Description stop codon in TK domain Date 27-Aug-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (27-Aug-1996) to the BTKbase. RefLoc Dr. Michael Weiss, prof. Dr. Bernd H. Belohradsky, RefLoc Abteilung fur Infektionsimmunologia, Dr. von Haunersches RefLoc Kinderspital Klinikum Innenstadt der Universitat, Munchen, RefLoc Lindwurmstrasse 4, D-80337 Munchen, Germany, RefLoc FAX 498 951 604 928. RefLoc Dr. Elke Holinski-Feder, Dr. Alfons Meindl, Abteilung fur RefLoc Padiatrische Genetik Kinderpoliklinik, Klinikum Innenstadt RefLoc der Universitat, Munchen, Goethestrasse 29, D-80336 RefLoc Munchen, Germany. RefNumber [2] RefCrossRef MEDLINE; 98118357 RefAuthors Holinski-Feder, E., Weiss M., Brandau, O., Jedele, K. B., RefAuthors Nore, B., Beckesj", C.-M., Vihinen, M., G"tz, G., Hubbard, RefAuthors S. R., Belohradsky, B. H., Smith, C. I. E., Meindl, A. RefTitle Mutation screening of the btk gene in 56 families with RefTitle X-linked agammaglobulinemia (XLA) - 47 unique mutations RefTitle without correlation to clinical course RefLoc Pediatrics 101:276-284(1998) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 67516 Feature /change: c -> g Feature /genomic_region: exon; 17 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1793 Feature /codon: tca -> tga; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 554 Feature /change: S -> X Feature /domain: TK Symptoms classical XLA Sex XY Age 2.5 IgA 0.14 IgG 0.80 IgM 0.28 CD19 3 Comment -!-Symptoms: airway infections, encephalopathy // ID BTK_HUMAN; ;K558X; KX Occurrence 1/1 Accession K178 DBCrossRef BTKbase:A0346 Original code 44-373 Description nonsense mutation in the exon 17 leading to Description stop codon in TK domain Date 03-Sep-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (03-Sep-1996) to the BTKbase. RefLoc Dr. Sau-Ping Kwan, Dept of Immunology, Rush Medical School, RefLoc Chigago, IL 60612, USA. Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 67527 Feature /change: a -> t Feature /genomic_region: exon; 17 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1804 Feature /codon: aaa -> taa; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 558 Feature /change: K -> X Feature /domain: TK Symptoms classical XLA Sex XY Family history inherited // ID BTK_HUMAN; ;F559S; FS Occurrence 1/1 Accession K179 DBCrossRef BTKbase:A0340 Original code BK Description missense mutation in the exon 17 leading to Description amino acid change in TK domain Date 27-Aug-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (27-Aug-1996) to the BTKbase. RefLoc Dr. Michael Weiss, prof. Dr. Bernd H. Belohradsky, RefLoc Abteilung fur Infektionsimmunologia, Dr. von Haunersches RefLoc Kinderspital Klinikum Innenstadt der Universitat, Munchen, RefLoc Lindwurmstrasse 4, D-80337 Munchen, Germany, RefLoc FAX 498 951 604 928. RefLoc Dr. Elke Holinski-Feder, Dr. Alfons Meindl, Abteilung fur RefLoc Padiatrische Genetik Kinderpoliklinik, Klinikum Innenstadt RefLoc der Universitat, Munchen, Goethestrasse 29, D-80336 RefLoc Munchen, Germany. RefNumber [2] RefCrossRef MEDLINE; 98118357 RefAuthors Holinski-Feder, E., Weiss M., Brandau, O., Jedele, K. B., RefAuthors Nore, B., Beckesj", C.-M., Vihinen, M., G"tz, G., Hubbard, RefAuthors S. R., Belohradsky, B. H., Smith, C. I. E., Meindl, A. RefTitle Mutation screening of the btk gene in 56 families with RefTitle X-linked agammaglobulinemia (XLA) - 47 unique mutations RefTitle without correlation to clinical course RefLoc Pediatrics 101:276-284(1998) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 67531 Feature /change: t -> c Feature /genomic_region: exon; 17 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1808 Feature /codon: ttt -> tct; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 559 Feature /change: F -> S Feature /domain: TK Symptoms classical XLA Sex XY Age 0.75 IgA 0.02 IgG 2.29 IgM 0.12 CD19 0 Comment -!-Family history: one affected brother // ID BTK_HUMAN; ;#V561X569; VDGGPHRKSX Occurrence 1/1 Accession K180 DBCrossRef BTKbase:A0205 Description frameshift deletion and an insertion in the exon 17 leading Description to stop codon in TK domain Date 25-Sep-1995 (Rel. 2, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 3) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 96177680 RefAuthors Vorechovsky, I., Luo, L., Genevieve, B., Hammarstrom, L., RefAuthors Webster, A. D. B., Smith, C. I. E. RefTitle Improved oligonucleotide primer set for molecular RefTitle diagnosis of X-linked agammaglobulinemia: predominance of RefTitle amino acid substitutions in the catalytic domain of RefTitle Bruton's tyrosine kinase RefLoc Hum. Molec. Genet. 4:2403-2405(1995) Feature dna; 1 Feature /rnalink; 3 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 67537..67538 Feature /change: -tc Feature /genomic_region: exon; 17 Feature dna; 2 Feature /rnalink; 3 Feature /name: insertion Feature /loc: EMBL: Hsu78027: 67537 Feature /change: +a Feature /genomic_region: exon;17 Feature /RE: +AspS9I, +AsuI, +AvaII, +BetI, +BetI, +BetI, Feature /RE: +BetI, +Bme18I, +BsaWI, +BsaWI, +BsaWI, +BsaWI, Feature /RE: +BscBI, +BscFI, +BsiSI, +BsiSI, +BsiSI, +BsiSI, Feature /RE: +BsiZI, +Bsp24I, +Bsp143I, +BspLI, +BstX2I, +BstYI, Feature /RE: +Cfr13I, +CjeI, +CjeI, +CjePI, +DpnI, +DpnII, Feature /RE: +Eco47I, +HapII, +HapII, +HapII, +HapII, +HgiEI, Feature /RE: +HpaII, +HpaII, +HpaII, +HpaII, +Hpy178III, +Hpy178III, Feature /RE: +Hpy178III, +Kzo9I, +MboI, +MflI, +MspI, +MspI, Feature /RE: +MspI, +MspI, +MspA1I, +NdeII, +NgoGV, +NlaIV, Feature /RE: +NspBII, +PspN4I, +Sau3AI, +Sau96I, +SinI, +XhoII, Feature /RE: Feature rna; 3 Feature /dnalink; 1 Feature /dnalink; 2 Feature /aalink; 4 Feature /name: frameshift Feature /loc: EMBL: X58957; G312467; HSATK: 1814..1815 Feature /codon: gtc -> ga Feature aa; 4 Feature /rnalink: 3 Feature /name: out of frame translation; premature termination Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 561 Feature /change: V -> DGGPHRKSX Feature /domain: TK mRNA level reduced Sex XY Family history inherited // ID BTK_HUMAN; ;R562P; RP Occurrence 1/1 Accession K181 DBCrossRef BTKbase:A0103 Description missense mutation in the exon 17 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_52 DB CrossRef SWISS-PROT; Q06187:562_562 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 67540 Feature /change: g -> c Feature /genomic_region: exon; 17 Feature /RE: +BsaJI, +BscGI, +BseDI, +BssECI, +BstDSI, +DsaI, Feature /RE: +SecI, +Sth132I, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1817 Feature /codon: cgg -> ccg; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 562 Feature /change: R -> P Feature /domain: TK Protein struct stabilization and orientation of W563; ref [1] Sex XY Family history inherited B cells surf Ig <1 // ID BTK_HUMAN; ;R562W; RW Occurrence 1/1 Accession K182 DBCrossRef BTKbase:A0075 Original code 288 Description missense mutation in the exon 17 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95152493 RefAuthors Hagemann, T. L., Chen, Y., Rosen, F. S., Kwan, S. RefTitle Genomic organization of the Btk gene and exon scanning for RefTitle mutations in the patients with X-linked RefTitle agammaglobulinemia RefLoc Hum. Molec. Genet. 3:1743-1749(1994) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef OMIM; 300300.0042 DB CrossRef SWISSCHANGE; BTK_HUMAN_53 DB CrossRef SWISS-PROT; Q06187:562_562 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 67539 Feature /change: c -> t Feature /CpG; 1 Feature /genomic_region: exon; 17 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1816 Feature /codon: cgg -> tgg; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 562 Feature /change: R -> W Feature /domain: TK Protein struct destabilization, orientation of W563; ref [2] Symptoms classical XLA Sex XY Family history de novo IgA hd IgE hd IgG < 10% IgM hd B cells surf Ig nd // ID BTK_HUMAN; ;R562W; RW Occurrence 1/1 Accession K183 DBCrossRef BTKbase:A0096 Original code 21 Description missense mutation in the exon 17 leading to Description aminoacid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95152494 RefAuthors Conley, M. E., Fitch-Hilgenberg, M. E., Cleveland, J. L. RefAuthors Parolini, O., Rohrer, J. RefTitle Screening of genomic DNA to indentify mutations in the RefTitle gene for Bruton's tyrosine kinase RefLoc Hum. Molec. Genet. 3: 1751-1756(1994) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef OMIM; 300300.0042 DB CrossRef SWISSCHANGE; BTK_HUMAN_53 DB CrossRef SWISS-PROT; Q06187:562_562 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 67539 Feature /change: c -> t Feature /CpG; 1 Feature /genomic_region: exon; 17 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1816 Feature /codon: cgg -> tgg; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 562 Feature /change: R -> W Feature /domain: TK Protein struct destabilization, orientation of W563; ref [2] Sex XY Family history inherited B cells surf Ig <1 // ID BTK_HUMAN; ;R562W; RW Occurrence 1/1 Accession K184 DBCrossRef BTKbase:A0121 Original code 7/15 Description missense mutation in the exon 17 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95227177 RefAuthors Vorechovsky, I., Vihinen, M., de Saint Basile, G., RefAuthors Honsova, S., Hammarstrom, L., Muller, S., Nilsson, L., RefAuthors Fischer, A., Smith, C. I. E. RefTitle DNA-based mutation analysis of Bruton's tyrosine gene RefTitle in patients with X-linked agammaglobulinemia RefLoc Hum. Molec. Genet. 4:51-58(1995) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_53 DB CrossRef SWISS-PROT; Q06187:562_562 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 67539 Feature /change: c -> t Feature /CpG; 1 Feature /genomic_region: exon; 17 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1816 Feature /codon: cgg -> tgg; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 562 Feature /change: R -> W Feature /domain: TK Protein struct destabilization, orientation of W563; ref [2] Symptoms classical XLA Sex XY Family history inherited // ID BTK_HUMAN; ;R562W; RW Occurrence 1/1 Accession K185 DBCrossRef BTKbase:A0341 Original code BM Description missense mutation in the exon 17 leading to Description amino acid change in TK domain Date 27-Aug-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (27-Aug-1996) to the BTKbase. RefLoc Dr. Michael Weiss, prof. Dr. Bernd H. Belohradsky, RefLoc Abteilung fur Infektionsimmunologia, Dr. von Haunersches RefLoc Kinderspital Klinikum Innenstadt der Universitat, Munchen, RefLoc Lindwurmstrasse 4, D-80337 Munchen, Germany, RefLoc FAX 498 951 604 928. RefLoc Dr. Elke Holinski-Feder, Dr. Alfons Meindl, Abteilung fur RefLoc Padiatrische Genetik Kinderpoliklinik, Klinikum Innenstadt RefLoc der Universitat, Munchen, Goethestrasse 29, D-80336 RefLoc Munchen, Germany. RefNumber [2] RefCrossRef MEDLINE; 98118357 RefAuthors Holinski-Feder, E., Weiss M., Brandau, O., Jedele, K. B., RefAuthors Nore, B., Beckesj", C.-M., Vihinen, M., G"tz, G., Hubbard, RefAuthors S. R., Belohradsky, B. H., Smith, C. I. E., Meindl, A. RefTitle Mutation screening of the btk gene in 56 families with RefTitle X-linked agammaglobulinemia (XLA) - 47 unique mutations RefTitle without correlation to clinical course RefLoc Pediatrics 101:276-284(1998) RefNumber [3] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_53 DB CrossRef SWISS-PROT; Q06187:562_562 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 67539 Feature /change: c -> t Feature /CpG; 1 Feature /genomic_region: exon; 17 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1816 Feature /codon: cgg -> tgg; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 562 Feature /change: R -> W Feature /domain: TK Protein struct destabilization, orientation of W563; ref [3] Symptoms classical XLA Sex XY Age 8 Comment -!-Symptoms: airway infections, pneumonias bronchiectasis // ID BTK_HUMAN; ;#R562X569; RCGPHRKSX Occurrence 1/1 Accession K186 DBCrossRef BTKbase:A0243 Original code 52/53 Description frameshift deletion and an insertion in the exon 17 leading Description to stop codon in the TK domain Date 02-Feb-1996 (Rel. 3, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 3) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 97288998 RefAuthors Vorechovsky, I., Luo, L., Hertz., J. M., Froland, S. S., RefAuthors Fiorini, N., Quinti, I., Paganelli, R., Segers, R., RefAuthors Hammarstrom, L., Webster, A. D. B., Smith, C. I. E. RefTitle Mutation pattern in the Bruton's tyrosine kinase gene in RefTitle 26 unrelated patients with X-linked agammaglobulinemia RefLoc Hum. Mut. 9:418-425 (1997) DB CrossRef ESID; NO 001 M63 G1 Feature dna; 1 Feature /rnalink; 3 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 67539..67540 Feature /change: -cg Feature /genomic_region: exon; 17 Feature dna; 2 Feature /rnalink; 3 Feature /name: insertion Feature /loc: EMBL: Hsu78027: 67541 Feature /change: +t Feature /genomic_region: exon;17 Feature /RE: +AspS9I, +AsuI, +AvaII, +BetI, +BetI, +BetI, Feature /RE: +BetI, +BetI, +Bme18I, +BsaWI, +BsaWI, +BsaWI, Feature /RE: +BsaWI, +BsaWI, +BscBI, +BsiSI, +BsiSI, +BsiSI, Feature /RE: +BsiSI, +BsiSI, +BsiZI, +Bsp24I, +BspLI, +Cfr13I, Feature /RE: +CjeI, +CjeI, +CjePI, +Eco47I, +HapII, +HapII, Feature /RE: +HapII, +HapII, +HapII, +HgiEI, +HpaII, +HpaII, Feature /RE: +HpaII, +HpaII, +HpaII, +Hpy178III, +MspI, +MspI, Feature /RE: +MspI, +MspI, +MspI, +NgoGV, +NlaIV, +PspN4I, Feature /RE: +Sau96I, +SinI, Feature rna; 3 Feature /dnalink; 1 Feature /dnalink; 2 Feature /aalink; 4 Feature /name: frameshift Feature /loc: EMBL: X58957; G312467; HSATK: 1816..1818 Feature aa; 4 Feature /rnalink: 3 Feature /name: out of frame translation; premature termination Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 562 Feature /change: R -> CGPHRKSX Feature /domain: TK mRNA level reduced Protein struct premature stop Sex XY Family history inherited // ID BTK_HUMAN; ;W563L; WL Occurrence 1/1 Accession K187 DBCrossRef BTKbase:A0503 Original code 2110 Description point in the exon 17 causing amino acid change in Description domain TK Date 28-Apr-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 98213565 RefAuthors Conley, M. E., Mathias, D., Treadaway, J., Minegishi, RefAuthors Y., Rohrer, J. RefTitle Mutations in Btk patients with presumed X-linked RefTitle agammaglobulinemia RefLoc Am J. Hum. Genet. 62:1034-1043(1998) Feature dna; 1 Feature /rnalink; 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 67543 Feature /change: g -> t Feature /genomic_region: exon;17 Feature rna; 2 Feature /dnalink; 1 Feature /aalink; 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1820 Feature /codon: tgg -> ttg; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: substitution Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 563 Feature /change: W -> L Feature /domain: TK Symptoms classical XLA Sex XY Family history inherited // ID BTK_HUMAN; ;#W563X569; WCPHRKS* Occurrence 1/1 Accession K188 DBCrossRef BTKbase:A0504 Original code 2116 Description deletion in the exon 17 Date 28-Apr-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 98213565 RefAuthors Conley, M. E., Mathias, D., Treadaway, J., Minegishi, RefAuthors Y., Rohrer, J. RefTitle Mutations in Btk patients with presumed X-linked RefTitle agammaglobulinemia RefLoc Am J. Hum. Genet. 62:1034-1043(1998) Feature dna; 1 Feature /rnalink; 2 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 67543 Feature /change: g -> Feature /genomic_region: exon;17 Feature rna; 2 Feature /dnalink; 1 Feature /aalink; 3 Feature /name: frameshift Feature /loc: EMBL: X58957; G312467; HSATK: 1820 Feature /codon: tgg -> -; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: out-of-frame extension Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 563 Feature /change: W -> CPHRKS* Feature /domain: TK Symptoms classical XLA Sex XY Family history inherited // ID BTK_HUMAN; ;W563X; WX Occurrence 1/1 Accession K189 DBCrossRef BTKbase:A0408 Description nonsense mutation in the exon 17 leading to Description stop codon in TK domain Date 27-Aug-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 3) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (27-Aug-1996) to the BTKbase. RefLoc Dr. Michael Weiss, prof. Dr. Bernd H. Belohradsky, RefLoc Abteilung fur Infektionsimmunologia, Dr. von Haunersches RefLoc Kinderspital Klinikum Innenstadt der Universitat, Munchen, RefLoc Lindwurmstrasse 4, D-80337 Munchen, Germany, RefLoc FAX 498 951 604 928. RefLoc Dr. Elke Holinski-Feder, Dr. Alfons Meindl, Abteilung fur RefLoc Padiatrische Genetik Kinderpoliklinik, Klinikum Innenstadt RefLoc der Universitat, Munchen, Goethestrasse 29, D-80336 RefLoc Munchen, Germany. RefNumber [2] RefCrossRef MEDLINE; 98118357 RefAuthors Holinski-Feder, E., Weiss M., Brandau, O., Jedele, K. B., RefAuthors Nore, B., Beckesj", C.-M., Vihinen, M., G"tz, G., Hubbard, RefAuthors S. R., Belohradsky, B. H., Smith, C. I. E., Meindl, A. RefTitle Mutation screening of the btk gene in 56 families with RefTitle X-linked agammaglobulinemia (XLA) - 47 unique mutations RefTitle without correlation to clinical course RefLoc Pediatrics 101:276-284(1998) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 67543 Feature /change: g -> a Feature /genomic_region: exon; 17 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1820 Feature /codon: tgg -> tag; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 563 Feature /change: W -> X Feature /domain: TK Sex XY // ID BTK_HUMAN; ;#P566X569; PPKSX Occurrence 1/1 Accession K190 DBCrossRef BTKbase:A0533 Original code BH Description frameshift deletion in the exon 17 leading to Description stop codon in TK domain Date 26-Oct-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (26-Oct-1998) to BTKbase. RefLoc Prof. Hans D. Ochs, Department of Pediatrics, Box RefLoc 356320, University of Washington, School of Medicine RefLoc Seattle, WA 98195-6320, e-mail allgau@u.washington.edu, RefLoc fax: 206 543 3184 Feature dna; 1 Feature /rnalink; 2 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 67553 Feature /change: -g Feature /genomic_region: exon;17 Feature rna; 2 Feature /dnalink; 1 Feature /aalink; 3 Feature /name: frameshift Feature /loc: EMBL: X58957; G312467; HSATK: 1830 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 566 Feature /change: P -> PKSX Feature /domain: TK Symptoms classical XLA // ID BTK_HUMAN; ;E567K; EK Occurrence 1/1 Accession K191 DBCrossRef BTKbase:A0135 Original code 40 Description missense mutation in the exon 17 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95359977 RefAuthors Jin, H., Webster, A. D. B., Vihinen, M., Sideras, P., RefAuthors Vorechovsky, I., Hammarstrom, L., RefAuthors Bernatowska-Matuszkiewicz, E., Smith, C. I. E., Bobrow, M., RefAuthors Vetrie, D. RefTitle Identification of Btk mutations in 20 unrelated patients RefTitle with X-linked agammaglobulinemia (XLA) RefLoc Hum. Molec. Genet. 4: 693-700(1995) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_54 DB CrossRef SWISS-PROT; Q06187:567_567 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 67554 Feature /change: g -> a Feature /genomic_region: exon; 17 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1831 Feature /codon: gaa -> aaa; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 567 Feature /change: E -> K Feature /domain: TK Protein struct distroys stabilizing ion bond with R641; ref [2] Symptoms classical XLA Sex XY Age 2 Family history de novo IgA < 0.2 IgG 2.0 IgM < 0.2 B cells surf Ig <1 // ID BTK_HUMAN; ;W581R; WR Occurrence 1/1 Accession K192 DBCrossRef BTKbase:A0097 Original code 22 Description missense mutation in the exon 17 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95152494 RefAuthors Conley, M. E., Fitch-Hilgenberg, M. E., Cleveland, J. L. RefAuthors Parolini, O., Rohrer, J. RefTitle Screening of genomic DNA to indentify mutations in the RefTitle gene for Bruton's tyrosine kinase RefLoc Hum. Molec. Genet. 3: 1751-1756(1994) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) RefNumber [3] RefCrossRef MEDLINE; 97092684 RefAuthors Farrar, J.E., Rohrer, J., Conley, M.-E. RefTitle Neutropenia in X-linked agammaglobulinemia RefLoc Clin. Immunol. Immunopathol. 81:271-276(1996) DB CrossRef OMIM; 300300.0043 DB CrossRef SWISSCHANGE; BTK_HUMAN_55 DB CrossRef SWISS-PROT; Q06187:581_581 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 67596 Feature /change: t -> c Feature /genomic_region: exon; 17 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1873 Feature /codon: tgg -> cgg; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 581 Feature /change: W -> R Feature /domain: TK mRNA level normal Protein struct destabilization of hydrophobic packing; ref [2] Symptoms classical XLA Sex XY Family history de novo B cells surf Ig <1 Comment -!-Symptoms: neutropenia; ref [3] // ID BTK_HUMAN; ;A582V; AV Occurrence 1/1 Accession K193 DBCrossRef BTKbase:A0104 Description missense mutation in the exon 17 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_56 DB CrossRef SWISS-PROT; Q06187:582_582 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 67600 Feature /change: c -> t Feature /genomic_region: exon; 17 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1877 Feature /codon: gct -> gtt; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 582 Feature /change: A -> V Feature /domain: TK Protein struct destabilization, orientation of W563; ref [1] Sex XY Family history inherited B cells surf Ig <1 // ID BTK_HUMAN; ;A582V; AV Occurrence 1/1 Accession K194 DBCrossRef BTKbase:A0122 Original code 18/13 Description missense mutation in the exon 17 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95227177 RefAuthors Vorechovsky, I., Vihinen, M., de Saint Basile, G., RefAuthors Honsova, S., Hammarstrom, L., Muller, S., Nilsson, L., RefAuthors Fischer, A., Smith, C. I. E. RefTitle DNA-based mutation analysis of Bruton's tyrosine gene RefTitle in patients with X-linked agammaglobulinemia RefLoc Hum. Molec. Genet. 4:51-58(1995) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_56 DB CrossRef SWISS-PROT; Q06187:582_582 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 67600 Feature /change: c -> t Feature /genomic_region: exon; 17 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1877 Feature /codon: gct -> gtt; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 582 Feature /change: A -> V Feature /domain: TK Protein struct destabilization, orientation of W563; ref [2] Sex XY Family history inherited // ID BTK_HUMAN; ;A582V; AV Occurrence 1/1 Accession K195 DBCrossRef BTKbase:A0259 Original code 22.1 Description missense mutation in the exon 17 leading to Description amino acid change in TK domain Date 09-Jan-1996 (Rel. 3, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 96007207 RefAuthors Conley, M. E., Rohrer, J. RefTitle The spectrum of mutations in Btk that cause X-linked RefTitle agammaglobulinemia RefLoc Clin. Immunol. Immunopathol. 76:S192-S197(1995) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) RefNumber [3] RefCrossRef MEDLINE; 97092684 RefAuthors Farrar, J.E., Rohrer, J., Conley, M.-E. RefTitle Neutropenia in X-linked agammaglobulinemia RefLoc Clin. Immunol. Immunopathol. 81:271-276(1996) DB CrossRef SWISSCHANGE; BTK_HUMAN_56 DB CrossRef SWISS-PROT; Q06187:582_582 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 67600 Feature /change: c -> t Feature /genomic_region: exon; 17 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1877 Feature /codon: gct -> gtt; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 582 Feature /change: A -> V Feature /domain: TK Symptoms classical XLA Sex XY Family history inherited Comment -!-Symptoms: neutropenia; ref [3] // ID BTK_HUMAN; ;#A582X586; AVLGFX Occurrence 1/1 Accession K196 DBCrossRef BTKbase:A0526 Original code G15916 Description frameshift deletion in the exon 17 leading to Description stop codon in TK domain. Date 16-Oct-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (16-Oct-1998) to BTKbase. RefLoc Dr. Tracy Lester, Clinical Molecular Genetics Laboratory, RefLoc Level 5, Camelia Botnar Laboratories, Great Ormond Street RefLoc Hospital for Children NHS Trust, Great Ormond Street, RefLoc London, WC1N 3JH, RefLoc e-mail tracy.lester@gosh-tr.nthames.nhs.uk Feature dna; 1 Feature /rnalink; 2 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 67600 Feature /change: -c Feature /genomic_region: exon;17 Feature rna; 2 Feature /dnalink; 1 Feature /aalink; 3 Feature /name: frameshift Feature /loc: EMBL: X58957; G312467; HSATK: 1877 Feature aa; 3 Feature /rnalink: 2 Feature /name: out-of-frame extension Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 582 Feature /change: A -> VLGFX Feature /domain: TK Symptoms classical XLA Sex XY Age 1.5 Family history inherited Ethnic origin - ; Spain IgA 0.01 IgG 0.28 IgM 0.033 CD19 0 Comment -!-Symptoms: Pneumonia // ID BTK_HUMAN; ;F583S; FS Occurrence 1/1 Accession K197 DBCrossRef BTKbase:A0527 Original code G7247 Description point mutation in the exon 17 causing amino acid Description change in domain TK Date 28-Oct-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (15-Oct-1998) to BTKbase. RefLoc Dr. Tracy Lester, Clinical Molecular Genetics Laboratory, RefLoc Level 5, Camelia Botnar Laboratories, Great Ormond Street RefLoc Hospital for Children NHS Trust, Great Ormond Street, RefLoc London, WC1N 3JH, RefLoc e-mail tracy.lester@gosh-tr.nthames.nhs.uk Feature dna; 1 Feature /rnalink; 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 67603 Feature /change: t -> c Feature /genomic_region: exon;17 Feature rna; 2 Feature /dnalink; 1 Feature /aalink; 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1880 Feature /codon: ttt -> tct; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: substitution Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 583 Feature /change: F -> S Feature /domain: TK Ethnic origin - ; United Kingdom // ID BTK_HUMAN; ;#V585X586; VFX Occurrence 1/1 Accession K198 DBCrossRef BTKbase:A0453 Original code cell line BT-8 Description frameshift deletion in the exon 17 leading to Description stop codon in TK domain Date 22-Sep-1997 (Rel. 5, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (22-Sep-1997) to the BTKbase. RefLoc Dr. Hans D. Ochs, Dept of Pediatrics, University of RefLoc Washington, Seattle, WA 98195, USA, RefLoc e-mail allgau@u.washington.edu. Feature dna; 1 Feature /rnalink: 2 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 67605 Feature /change: -g Feature /genomic_region: exon; 17 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: frameshift Feature /loc: EMBL: X58957; G312467; HSATK: 1882 Feature /note: deletion of exon 17 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 585 Feature /change: V -> FX Feature /domain: TK Protein struct premature stop Sex XY // ID BTK_HUMAN; ;M587L; ML Occurrence 1/1 Accession K199 DBCrossRef BTKbase:A0136 Original code 39 Description missense mutation in the exon 18 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95359977 RefAuthors Jin, H., Webster, A. D. B., Vihinen, M., Sideras, P., RefAuthors Vorechovsky, I., Hammarstrom, L., RefAuthors Bernatowska-Matuszkiewicz, E., Smith, C. I. E., Bobrow, M., RefAuthors Vetrie, D. RefTitle Identification of Btk mutations in 20 unrelated patients RefTitle with X-linked agammaglobulinemia (XLA) RefLoc Hum. Molec. Genet. 4: 693-700(1995) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_57 DB CrossRef SWISS-PROT; Q06187:587_587 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68133 Feature /change: a -> c Feature /genomic_region: exon; 18 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1891 Feature /codon: atg -> ctg; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 587 Feature /change: M -> L Feature /domain: TK Protein struct destabilization of hydrophobic packing; ref [2] Symptoms mild XLA Sex XY Age 13 Family history de novo IgA 0.1 IgG 2.2 IgM 0.3 B cells surf Ig 2 // ID BTK_HUMAN; ;W588X; WX Occurrence 1/1 Accession K200 DBCrossRef BTKbase:A0505 Original code 2270 Description point in the exon 18 leading to stop codon in domain TK Date 28-Apr-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 98213565 RefAuthors Conley, M. E., Mathias, D., Treadaway, J., Minegishi, RefAuthors Y., Rohrer, J. RefTitle Mutations in Btk patients with presumed X-linked RefTitle agammaglobulinemia RefLoc Am J. Hum. Genet. 62:1034-1043(1998) Feature dna; 1 Feature /rnalink; 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68137 Feature /change: g -> a Feature /genomic_region: exon;18 Feature rna; 2 Feature /dnalink; 1 Feature /aalink; 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1895 Feature /codon: tgg -> tag; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: premature termination Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 588 Feature /change: W -> X Feature /domain: TK Symptoms classical XLA Sex XY Family history de novo // ID BTK_HUMAN; ;W588X; WX Occurrence 1/1 Accession K201 DBCrossRef BTKbase:A0506 Original code 2273 Description point in the exon 18 leading to stop codon in domain TK Date 28-Apr-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 98213565 RefAuthors Conley, M. E., Mathias, D., Treadaway, J., Minegishi, RefAuthors Y., Rohrer, J. RefTitle Mutations in Btk patients with presumed X-linked RefTitle agammaglobulinemia RefLoc Am J. Hum. Genet. 62:1034-1043(1998) Feature dna; 1 Feature /rnalink; 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68137 Feature /change: g -> a Feature /genomic_region: exon;18 Feature rna; 2 Feature /dnalink; 1 Feature /aalink; 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1895 Feature /codon: tgg -> tag; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: premature termination Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 588 Feature /change: W -> X Feature /domain: TK Symptoms classical XLA Sex XY Family history de novo // ID BTK_HUMAN; ;E589D; ED Occurrence 1/1 Accession K202 DBCrossRef BTKbase:A0260 Original code 22.8 Description missense mutation in the exon 18 leading to Description amino acid change in TK domain Date 09-Jan-1996 (Rel. 3, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 96007207 RefAuthors Conley, M. E., Rohrer, J. RefTitle The spectrum of mutations in Btk that cause X-linked RefTitle agammaglobulinemia RefLoc Clin. Immunol. Immunopathol. 76:S192-S197(1995) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68141 Feature /change: a -> t Feature /genomic_region: exon; 18 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1899 Feature /codon: gaa -> gat; 3 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 589 Feature /change: E -> D Feature /domain: TK Protein struct affects substrate binding; ref [2] Sex XY Family history inherited // ID BTK_HUMAN; ;E589G; EG Occurrence 3/3 Accession K203 DBCrossRef BTKbase:A0061 Description missense mutation in the exon 18 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) RefNumber [2] RefCrossRef MEDLINE; 95152522 RefAuthors Zhu, Q., Zhang, M., Winkelstein, J., Chen., S., Ochs, H.D. RefTitle Unique mutations of Bruton's tyrosine kinase in fourteen RefTitle unrelated X-linked agammaglobulinemia families RefLoc Hum. Molec. Genet. 3:1899-1900(1994) DB CrossRef OMIM; 300300.0044 DB CrossRef SWISSCHANGE; BTK_HUMAN_58 DB CrossRef SWISS-PROT; Q06187:589_589 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68140 Feature /change: a -> g Feature /genomic_region: exon; 18 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1898 Feature /codon: gaa -> gga; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 589 Feature /change: E -> G Feature /domain: TK Protein struct affects substrate binding; ref [1] Symptoms moderate XLA Sex XY Family history inherited Relative BTK; A0062 Relative BTK; A0063 B cells surf Ig <1 // ID BTK_HUMAN; ;Y591X; YX Occurrence 1/1 Accession K206 DBCrossRef BTKbase:A0098 Original code 23 Description nonsense mutation in the exon 18 leading to Description stop condon in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95152494 RefAuthors Conley, M. E., Fitch-Hilgenberg, M. E., Cleveland, J. L. RefAuthors Parolini, O., Rohrer, J. RefTitle Screening of genomic DNA to indentify mutations in the RefTitle gene for Bruton's tyrosine kinase RefLoc Hum. Molec. Genet. 3: 1751-1756(1994) RefNumber [2] RefCrossRef MEDLINE; 97092684 RefAuthors Farrar, J.E., Rohrer, J., Conley, M.-E. RefTitle Neutropenia in X-linked agammaglobulinemia RefLoc Clin. Immunol. Immunopathol. 81:271-276(1996) DB CrossRef OMIM; 300300.0045 DB CrossRef SWISSCHANGE; BTK_HUMAN_59 DB CrossRef SWISS-PROT; Q06187:591_591 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68147 Feature /change: c -> a Feature /genomic_region: exon; 18 Feature /RE: +MseI, +Tru1I, +Tru9I, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1905 Feature /codon: tac -> taa; 3 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 591 Feature /change: Y -> X Feature /domain: TK Protein struct premature stop Sex XY Family history de novo B cells surf Ig <1 Comment -!-Symptoms: neutropenia; ref[2] // ID BTK_HUMAN; ;S592P; SP Occurrence 1/1 Accession K207 DBCrossRef BTKbase:A0219 Original code P12 Description missense mutation in the exon 18 leading to Description amino acid change in TK domain Date 26-Sep-1995 (Rel. 3, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 96431154 RefAuthors Kobayashi, S., Iwata, T., Saito, M., Iwasaki, R., RefAuthors Matsumoto, H., Naritaka, S., Kono, Y., Hayashi, Y. RefTitle Mutations of the Btk gene in 12 unrelated families RefTitle with X-linked agammaglobulinemia in Japan RefLoc Hum. Genet. 97:424-430(1996) DB CrossRef SWISSCHANGE; BTK_HUMAN_60 DB CrossRef SWISS-PROT; Q06187:592_592 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68148 Feature /change: t -> c Feature /genomic_region: exon; 18 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1906 Feature /codon: tcc -> ccc; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 592 Feature /change: S -> P Feature /domain: TK Symptoms classical XLA Sex XY Age 0.66 Family history inherited IgA < 0.20 IgG 0.06 IgM < 0.20 B cells surf Ig 10 // ID BTK_HUMAN; ;G594E; GE Occurrence 3/3 Accession K208 DBCrossRef BTKbase:A0105 Description missense mutation in the exon 18 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_61 DB CrossRef SWISS-PROT; Q06187:594_594 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68155 Feature /change: g -> a Feature /genomic_region: exon; 18 Feature /RE: +BpmI, +GsuI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1913 Feature /codon: ggg -> gag; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 594 Feature /change: G -> E Feature /domain: TK Protein struct affects substrate binding; ref [1] Symptoms mild XLA Sex XY Family history inherited Relative BTK; A0106; brother Relative BTK; A0187; uncle IgG 1.3 B cells surf Ig 1 Comment -!-Symptoms: growth hormone deficiency // ID BTK_HUMAN; ;G594E; GE Occurrence 1/1 Accession K211 DBCrossRef BTKbase:A0385 Description missense mutation in the exon 18 leading to Description amino acid change in TK domain Date 27-Aug-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (27-Aug-1996) to the BTKbase. RefLoc Dr. Michael Weiss, prof. Dr. Bernd H. Belohradsky, RefLoc Abteilung fur Infektionsimmunologia, Dr. von Haunersches RefLoc Kinderspital Klinikum Innenstadt der Universitat, Munchen, RefLoc Lindwurmstrasse 4, D-80337 Munchen, Germany, RefLoc FAX 498 951 604 928. RefLoc Dr. Elke Holinski-Feder, Dr. Alfons Meindl, Abteilung fur RefLoc Padiatrische Genetik Kinderpoliklinik, Klinikum Innenstadt RefLoc der Universitat, Munchen, Goethestrasse 29, D-80336 RefLoc Munchen, Germany. RefNumber [2] RefCrossRef MEDLINE; 98118357 RefAuthors Holinski-Feder, E., Weiss M., Brandau, O., Jedele, K. B., RefAuthors Nore, B., Beckesj", C.-M., Vihinen, M., G"tz, G., Hubbard, RefAuthors S. R., Belohradsky, B. H., Smith, C. I. E., Meindl, A. RefTitle Mutation screening of the btk gene in 56 families with RefTitle X-linked agammaglobulinemia (XLA) - 47 unique mutations RefTitle without correlation to clinical course RefLoc Pediatrics 101:276-284(1998) RefNumber [3] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_61 DB CrossRef SWISS-PROT; Q06187:594_594 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68155 Feature /change: g -> a Feature /genomic_region: exon; 18 Feature /RE: +BpmI, +GsuI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1913 Feature /codon: ggg -> gag; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 594 Feature /change: G -> E Feature /domain: TK Protein struct affects substrate binding; ref [3] Sex XY // ID BTK_HUMAN; ;G594E; GE Occurrence 1/1 Accession K212 DBCrossRef BTKbase:A0417 Original code 45-369 Description missense mutation in the exon 18 leading to Description amino acid change in TK domain Date 20-Aug-1997 (Rel. 5, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (20-AUg-1997) to the BTKbase. RefLoc Dr. Sau-Ping Kwan, Dept of Immunology, Rush Medical School, RefLoc Chigago, IL 60612, USA. RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_61 DB CrossRef SWISS-PROT; Q06187:594_594 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68155 Feature /change: g -> a Feature /genomic_region: exon; 18 Feature /RE: +BpmI, +GsuI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1913 Feature /codon: ggg -> gag; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 594 Feature /change: G -> E Feature /domain: TK Protein struct affects substrate binding; ref [2] Sex XY Family history de novo // ID BTK_HUMAN; ;G594E; GE Occurrence 1/1 Accession K213 DBCrossRef BTKbase:A0507 Original code 2320 Description missense mutation in the exon 18 leading to Description amino acid change in TK domain Date 28-Apr-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 98213565 RefAuthors Conley, M. E., Mathias, D., Treadaway, J., Minigichi, RefAuthors Y., Rohrer, J. RefTitle Mutations in Btk in patients with presumed X-linked RefTitle agammaglobulinemia RefLoc Am. J. Hum. Genet. 62:1034-1043(1998) DB CrossRef SWISSCHANGE; BTK_HUMAN_61 DB CrossRef SWISS-PROT; Q06187:594_594 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68155 Feature /change: g -> a Feature /genomic_region: exon; 18 Feature /RE: +BpmI, +GsuI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1913 Feature /codon: ggg -> gag; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 594 Feature /change: G -> E Feature /domain: TK Protein struct affects substrate binding; ref [1] Symptoms mild XLA Sex XY Family history sporadic // ID BTK_HUMAN; ;G594R; GR Occurrence 1/1 Accession K214 DBCrossRef BTKbase:A0123 Original code 20/17 Description missense mutation in the exon 18 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95227177 RefAuthors Vorechovsky, I., Vihinen, M., de Saint Basile, G., RefAuthors Honsova, S., Hammarstrom, L., Muller, S., Nilsson, L., RefAuthors Fischer, A., Smith, C. I. E. RefTitle DNA-based mutation analysis of Bruton's tyrosine gene RefTitle in patients with X-linked agammaglobulinemia RefLoc Hum. Molec. Genet. 4:51-58(1995) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_62 DB CrossRef SWISS-PROT; Q06187:594_594 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68154 Feature /change: g -> a Feature /genomic_region: exon; 18 Feature /RE: +AocI, +AxyI, +Bse21I, +BstDEI, +Bsu36I, +CvnI, Feature /RE: +DdeI, +Eco81I, +SauI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1912 Feature /codon: ggg -> agg; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 594 Feature /change: G -> R Feature /domain: TK Protein struct affects substrate binding; ref [2] Sex XY Family history inherited // ID BTK_HUMAN; ;Y598C; YC Occurrence 1/1 Accession K215 DBCrossRef BTKbase:A0244 Original code 44 Description missense mutation in the exon 18 leading to Description amino acid change in TK domain Date 02-Feb-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 97288998 RefAuthors Vorechovsky, I., Luo, L., Hertz., J. M., Froland, S. S., RefAuthors Fiorini, N., Quinti, I., Paganelli, R., Segers, R., RefAuthors Hammarstrom, L., Webster, A. D. B., Smith, C. I. E. RefTitle Mutation pattern in the Bruton's tyrosine kinase gene in RefTitle 26 unrelated patients with X-linked agammaglobulinemia RefLoc Hum. Mut. 9:418-425 (1997) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef ESID; GB 0577 M63 G1 DB CrossRef SWISSCHANGE; BTK_HUMAN_63 DB CrossRef SWISS-PROT; Q06187:598_598 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68167 Feature /change: a -> g Feature /genomic_region: exon; 18 Feature /RE: +Hsp92II, +NlaIII, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1925 Feature /codon: tat -> tgt; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 598 Feature /change: Y -> C Feature /domain: TK Sex XY Family history inherited // ID BTK_HUMAN; ;R600X; RX Occurrence 1/1 Accession K216 DBCrossRef BTKbase:A0201 Original code CT Description nonsense mutation in the exon 18 leading to Description amino acid change in TK domain Date 25-Sep-1995 (Rel. 2, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (08-Sept-1995) to the BTKbase. RefLoc Dr. Hans D. Ochs, Dept of Pediatrics, University of RefLoc Washington, Seattle, WA 98195, USA, RefLoc e-mail allgau@u.washington.edu. Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68172 Feature /change: a -> t Feature /genomic_region: exon; 18 Feature /RE: +MslI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1930 Feature /codon: aga -> tga; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 600 Feature /change: R -> X Feature /domain: TK Protein struct premature stop Symptoms classical XLA Sex XY Family history inherited // ID BTK_HUMAN; ;@E605+2; +DS Occurrence 1/1 Accession K217 DBCrossRef BTKbase:A0342 Original code SP Description inframe insertion in the exon 18 in TK domain Date 27-Aug-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (27-Aug-1996) to the BTKbase. RefLoc Dr. Michael Weiss, prof. Dr. Bernd H. Belohradsky, RefLoc Abteilung fur Infektionsimmunologia, Dr. von Haunersches RefLoc Kinderspital Klinikum Innenstadt der Universitat, Munchen, RefLoc Lindwurmstrasse 4, D-80337 Munchen, Germany, RefLoc FAX 498 951 604 928. RefLoc Dr. Elke Holinski-Feder, Dr. Alfons Meindl, Abteilung fur RefLoc Padiatrische Genetik Kinderpoliklinik, Klinikum Innenstadt RefLoc der Universitat, Munchen, Goethestrasse 29, D-80336 RefLoc Munchen, Germany. RefNumber [2] RefCrossRef MEDLINE; 98118357 RefAuthors Holinski-Feder, E., Weiss M., Brandau, O., Jedele, K. B., RefAuthors Nore, B., Beckesj", C.-M., Vihinen, M., G"tz, G., Hubbard, RefAuthors S. R., Belohradsky, B. H., Smith, C. I. E., Meindl, A. RefTitle Mutation screening of the btk gene in 56 families with RefTitle X-linked agammaglobulinemia (XLA) - 47 unique mutations RefTitle without correlation to clinical course RefLoc Pediatrics 101:276-284(1998) Feature dna; 1 Feature /rnalink: 2 Feature /name: insertion Feature /loc: EMBL: Hsu78027: 68187 Feature /change: +gacagt Feature /genomic_region: exon; 18 Feature /RE: +AatI, +BsaJI, +BseDI, +BshI, +BssECI, +BssT1I, Feature /RE: +Bst4CI, +Bst4CI, +BsuRI, +CviJI, +Eco130I, +Eco147I, Feature /RE: +EcoT14I, +ErhI, +HaeI, +HaeIII, +MaeIII, +PalI, Feature /RE: +Pme55I, +SecI, +SseBI, +StuI, +StyI, +TaaI, Feature /RE: +TaaI, +Tsp45I, +Tsp4CI, +Tsp4CI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: inframe_insertion Feature /loc:EMBL: X58957; G312467; HSATK: 1945 Feature aa; 3 Feature /rnalink: 2 Feature /name: Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 605 Feature /change: +DS Feature /domain: TK Symptoms classical XLA Sex XY Age 4 IgA < 0.01 IgG 1.05 IgM 0.10 B cells surf Ig 0 Comment -!-Symptoms: airway infections, H. influenzae meningitis, Comment pneumonia // ID BTK_HUMAN; ;A607D; AD Occurrence 3/3 Accession K218 DBCrossRef BTKbase:A0016 Original code TF Description missense mutation in the exon 18 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 94214481 RefAuthors Bradley, L.A.D., Sweatman, A.K., Lovering, R.C., Jones, RefAuthors A.M., Morgan, G., Levinsky, R.J., Kinnon, C. RefTitle Mutation detection in the X-linked agammaglobulinemia RefTitle gene, BTK, using single strand conformation polymorphism RefTitle analysis RefLoc Hum. Molec. Genet. 3:79-83(1994) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef OMIM; 300300.0046 DB CrossRef SWISSCHANGE; BTK_HUMAN_64 DB CrossRef SWISS-PROT; Q06187:607_607 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68194 Feature /change: c -> a Feature /genomic_region: exon; 18 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1952 Feature /codon: gct -> gat; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 607 Feature /change: A -> D Feature /domain: TK Protein struct domain-domain interactions; ref [2] Symptoms moderate XLA Sex XY Family history inherited Relative BTK; A0017; brother Relative BTK; A0018; brother IgA 0.46 IgE normal IgG 8.09 IgG1 4.88 IgG2 < 0.03 IgG3 0.30 IgG4 0.12 IgM 0.25 B cells surf Ig 1 // ID BTK_HUMAN; ;A607D; AD Occurrence 2/2 Accession K221 DBCrossRef BTKbase:A0343 Original code MB Description missense mutation in the exon 18 leading to Description amino acid change in TK domain Date 27-Aug-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (27-Aug-1996) to the BTKbase. RefLoc Dr. Michael Weiss, prof. Dr. Bernd H. Belohradsky, RefLoc Abteilung fur Infektionsimmunologia, Dr. von Haunersches RefLoc Kinderspital Klinikum Innenstadt der Universitat, Munchen, RefLoc Lindwurmstrasse 4, D-80337 Munchen, Germany, RefLoc FAX 498 951 604 928. RefLoc Dr. Elke Holinski-Feder, Dr. Alfons Meindl, Abteilung fur RefLoc Padiatrische Genetik Kinderpoliklinik, Klinikum Innenstadt RefLoc der Universitat, Munchen, Goethestrasse 29, D-80336 RefLoc Munchen, Germany. RefNumber [2] RefCrossRef MEDLINE; 98118357 RefAuthors Holinski-Feder, E., Weiss M., Brandau, O., Jedele, K. B., RefAuthors Nore, B., Beckesj", C.-M., Vihinen, M., G"tz, G., Hubbard, RefAuthors S. R., Belohradsky, B. H., Smith, C. I. E., Meindl, A. RefTitle Mutation screening of the btk gene in 56 families with RefTitle X-linked agammaglobulinemia (XLA) - 47 unique mutations RefTitle without correlation to clinical course RefLoc Pediatrics 101:276-284(1998) RefNumber [3] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_64 DB CrossRef SWISS-PROT; Q06187:607_607 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68194 Feature /change: c -> a Feature /genomic_region: exon; 18 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1952 Feature /codon: gct -> gat; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 607 Feature /change: A -> D Feature /domain: TK Protein struct domain-domain interactions; ref [3] Symptoms classical XLA Sex XY Age 3 Relative BTK; A0344; brother IgA 0.02 IgG 1.62 IgM 0.09 CD19 3 Comment -!-Symptoms: airway infections, H. influenzae meningitis, Comment bronchiectasis // ID BTK_HUMAN; ;Q612X; QX Occurrence 1/1 Accession K223 DBCrossRef BTKbase:A0437 Original code G11864 Description nonsense mutation in the exon 18 leading to Description amino acid change in TK domain Date 07-Sep-1997 (Rel. 5, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (07-Sep-1997) to the BTKbase. RefLoc Dr. Tracy Lester, Unit of Clinical Genetics, Institute RefLoc of Child Health, 30 Guilford Street, London, WC1N 1EH, RefLoc Tel 0171 242 9789 ext 2284, Fax 0171 404 6191 RefLoc e-mail T.Lester@ich.ucl.ac.uk Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68208 Feature /change: c -> t Feature /genomic_region: exon; 18 Feature /RE: +AocI, +AxyI, +Bse21I, +BstDEI, +Bsu36I, +CvnI, Feature /RE: +DdeI, +Eco81I, +SauI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 1966 Feature /note: destroys StyI site Feature /note: generates DdeI site Feature /codon: caa -> taa; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 612 Feature /change: Q -> X Feature /domain: TK Protein struct premature stop Symptoms classical XLA Sex XY Ethnic origin Caucasoid; Spain Family history inherited // ID BTK_HUMAN; ;G613D; GD Occurrence 2/2 Accession K224 DBCrossRef BTKbase:A0064 Description missense mutation in the exon 18 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) RefNumber [2] RefCrossRef MEDLINE; 95152522 RefAuthors Zhu, Q., Zhang, M., Winkelstein, J., Chen., S., Ochs, H.D. RefTitle Unique mutations of Bruton's tyrosine kinase in fourteen RefTitle unrelated X-linked agammaglobulinemia families RefLoc Hum. Molec. Genet. 3:1899-1900(1994) DB CrossRef OMIM; 300300.0047 DB CrossRef SWISSCHANGE; BTK_HUMAN_65 DB CrossRef SWISS-PROT; Q06187:613_613 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68212 Feature /change: g -> a Feature /genomic_region: exon; 18 Feature /RE: +PshAI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1970 Feature /codon: ggc -> gac; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 613 Feature /change: G -> D Feature /domain: TK Protein struct domain-domain interactions; ref [2] Symptoms mild XLA Sex XY Family history inherited Relative BTK; A0065; brother // ID BTK_HUMAN; ;G613D; GD Occurrence 2/2 Accession K226 DBCrossRef BTKbase:A0530 Original code G15915a Description missense mutation in the exon 18 leading to Description amino acid change in TK domain Date 15-Oct-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (15-Oct-1998) to BTKbase. RefLoc Dr. Tracy Lester, Clinical Molecular Genetics Laboratory, RefLoc Level 5, Camelia Botnar Laboratories, Great Ormond Street RefLoc Hospital for Children NHS Trust, Great Ormond Street, RefLoc London, WC1N 3JH, RefLoc e-mail tracy.lester@gosh-tr.nthames.nhs.uk DB CrossRef SWISSCHANGE; BTK_HUMAN_65 DB CrossRef SWISS-PROT; Q06187:613_613 Feature dna; 1 Feature /rnalink; 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68212 Feature /change: g -> a Feature /genomic_region: exon;18 Feature /RE: +PshAI, Feature rna; 2 Feature /dnalink; 1 Feature /aalink; 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1970 Feature /codon: ggc -> gac; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: substitution Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 613 Feature /change: G -> D Feature /domain: TK Symptoms classical XLA Sex XY Age 0.3 Family history inherited Ethnic origin - ; Spain IgA nd IgG 0.417 IgM 0.213 CD19 0 Comment -!-Symptoms: pneumonia // ID BTK_HUMAN; ;P619A; PA Occurrence 1/1 Accession K228 DBCrossRef BTKbase:A0438 Original code G7996 Description missense mutation in the exon 18 leading to Description amino acid change in TK domain Date 07-Sep-1997 (Rel. 5, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (07-Sep-1997) to the BTKbase. RefLoc Dr. Tracy Lester, Unit of Clinical Genetics, Institute RefLoc of Child Health, 30 Guilford Street, London, WC1N 1EH, RefLoc Tel 0171 242 9789 ext 2284, Fax 0171 404 6191 RefLoc e-mail T.Lester@ich.ucl.ac.uk Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68229 Feature /change: c -> g Feature /genomic_region: exon; 18 Feature /RE: +BanII, +CviJI, +Eco24I, +EcoT38I, +FriOI, +HgiJII, Feature /RE: +MwoI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1987 Feature /note: destroys Hae III site Feature /codon: cct -> gct; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 619 Feature /change: P -> A Feature /domain: TK Symptoms classical XLA Sex XY Ethnic origin Caucasoid; Spain Family history inherited // ID BTK_HUMAN; ;P619S; PS Occurrence 1/1 Accession K229 DBCrossRef BTKbase:A0245 Original code 39 Description missense mutation in the exon 18 leading to Description amino acid change in TK domain Date 02-Feb-1996 (Rel. 3, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 97288998 RefAuthors Vorechovsky, I., Luo, L., Hertz., J. M., Froland, S. S., RefAuthors Fiorini, N., Quinti, I., Paganelli, R., Segers, R., RefAuthors Hammarstrom, L., Webster, A. D. B., Smith, C. I. E. RefTitle Mutation pattern in the Bruton's tyrosine kinase gene in RefTitle 26 unrelated patients with X-linked agammaglobulinemia RefLoc Hum. Mut. 9:418-425 (1997) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef ESID; SE 0756 M92 G1 DB CrossRef SWISSCHANGE; BTK_HUMAN_66 DB CrossRef SWISS-PROT; Q06187:619_619 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68229 Feature /change: c -> t Feature /genomic_region: exon; 18 Feature /RE: +Alw26I, +Alw26I, +BsaI, +BsmAI, +BsmAI, +Eco31I, Feature /RE: Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1987 Feature /codon: cct -> tct; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 619 Feature /change: P -> S Feature /domain: TK mRNA level normal Protein struct affects turn formation; ref [2] Sex XY Family history inherited // ID BTK_HUMAN; ;P619S; PS Occurrence 1/1 Accession K230 DBCrossRef BTKbase:A0246 Original code 59 Description missense mutation in the exon 18 leading to Description amino acid change in TK domain Date 02-Feb-1996 (Rel. 3, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 97288998 RefAuthors Vorechovsky, I., Luo, L., Hertz., J. M., Froland, S. S., RefAuthors Fiorini, N., Quinti, I., Paganelli, R., Segers, R., RefAuthors Hammarstrom, L., Webster, A. D. B., Smith, C. I. E. RefTitle Mutation pattern in the Bruton's tyrosine kinase gene in RefTitle 26 unrelated patients with X-linked agammaglobulinemia RefLoc Hum. Mut. 9:418-425 (1997) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef ESID; GB 1234 M70 G1 DB CrossRef SWISSCHANGE; BTK_HUMAN_66 DB CrossRef SWISS-PROT; Q06187:619_619 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68229 Feature /change: c -> t Feature /genomic_region: exon; 18 Feature /RE: +Alw26I, +Alw26I, +BsaI, +BsmAI, +BsmAI, +Eco31I, Feature /RE: Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1987 Feature /codon: cct -> tct; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 619 Feature /change: P -> S Feature /domain: TK Protein struct affects turn formation; ref [2] Sex XY Family history inherited // ID BTK_HUMAN; ;P619T; PT Occurrence 1/1 Accession K231 DBCrossRef BTKbase:A0379 Description missense mutation in exon 18 leading to Description amino acid change in TK domain Date 15-May-1997 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (27-Aug-1996) to the BTKbase. RefLoc Dr. Michael Weiss, prof. Dr. Bernd H. Belohradsky, RefLoc Abteilung fur Infektionsimmunologia, Dr. von Haunersches RefLoc Kinderspital Klinikum Innenstadt der Universitat, Munchen, RefLoc Lindwurmstrasse 4, D-80337 Munchen, Germany, RefLoc FAX 498 951 604 928. RefLoc Dr. Elke Holinski-Feder, Dr. Alfons Meindl, Abteilung fur RefLoc Padiatrische Genetik Kinderpoliklinik, Klinikum Innenstadt RefLoc der Universitat, Munchen, Goethestrasse 29, D-80336 RefLoc Munchen, Germany. RefNumber [2] RefCrossRef MEDLINE; 98118357 RefAuthors Holinski-Feder, E., Weiss M., Brandau, O., Jedele, K. B., RefAuthors Nore, B., Beckesj", C.-M., Vihinen, M., G"tz, G., Hubbard, RefAuthors S. R., Belohradsky, B. H., Smith, C. I. E., Meindl, A. RefTitle Mutation screening of the btk gene in 56 families with RefTitle X-linked agammaglobulinemia (XLA) - 47 unique mutations RefTitle without correlation to clinical course RefLoc Pediatrics 101:276-284(1998) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68229 Feature /change: c -> a Feature /genomic_region: exon; 18 Feature /RE: +HinfI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1987 Feature /codon: cct -> act; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 619 Feature /change: P -> T Feature /domain: TK Sex XY // ID BTK_HUMAN; ;#L621X648; LLLQRRYIPSCTVVGMRKQMSVPLSKFFX Occurrence 1/1 Accession K232 DBCrossRef BTKbase:A0536 Original code MW Description frameshift deletion in the exon 18 leading to stop codon in Description TK domain Date 26-Oct-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (26-Oct-1998) to BTKbase. RefLoc Prof. Hans D. Ochs, Department of Pediatrics, Box RefLoc 356320, University of Washington, School of Medicine RefLoc Seattle, WA 98195-6320, e-mail allgau@u.washington.edu, RefLoc fax: 206 543 3184 Feature dna; 1 Feature /rnalink; 2 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 68237 Feature /change: -g Feature /genomic_region: exon;18 Feature /RE: +MwoI, Feature rna; 2 Feature /dnalink; 1 Feature /aalink; 3 Feature /name: frameshift Feature /loc: EMBL: X58957; G312467; HSATK: 1995 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 621 Feature /change: L -> LLQRRYIPSCTVVGMRKQMSVPLSKFFX Feature /domain: TK Symptoms classical XLA // ID BTK_HUMAN; ;A622P; AP Occurrence 1/1 Accession K233 DBCrossRef BTKbase:A0469 Original code 23.70 Description point in the exon 18 causingamino acid change in Description the kinase domain Date 25-Apr-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 97092684 RefAuthors Farrar, J. E., Rohrer, J., Conley, M. E. RefTitle Neutropenia in X-linked agammaglobulinemia RefLoc Clin. Immunol. Immunopathol. 81:271-276(1996) RefNumber [2] RefCrossRef MEDLINE; 98213565 RefAuthors Conley, M. E., Mathias, D., Treadaway, J., Minegishi, RefAuthors Y., Rohrer, J. RefTitle Mutations in Btk patients with presumed X-linked RefTitle agammaglobulinemia RefLoc Am J. Hum. Genet. 62:1034-1043(1998) Feature dna; 1 Feature /rnalink; 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68238 Feature /change: g -> c Feature /genomic_region: exon;18 Feature /RE: +MwoI, Feature rna; 2 Feature /dnalink; 1 Feature /aalink; 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 1996 Feature /codon: gct -> cct; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: substitution Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 622 Feature /change: A -> P Feature /domain: TK Symptoms classical XLA Sex XY Family history de novo Comment -!-Symptoms: neutropenia // ID BTK_HUMAN; ;V626G; VG Occurrence 1/1 Accession K234 DBCrossRef BTKbase:A0345 Original code EM Description missense mutation in the exon 18 leading to Description amino acid change in TK domain Date 27-Aug-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (27-Aug-1996) to the BTKbase. RefLoc Dr. Michael Weiss, prof. Dr. Bernd H. Belohradsky, RefLoc Abteilung fur Infektionsimmunologia, Dr. von Haunersches RefLoc Kinderspital Klinikum Innenstadt der Universitat, Munchen, RefLoc Lindwurmstrasse 4, D-80337 Munchen, Germany, RefLoc FAX 498 951 604 928. RefLoc Dr. Elke Holinski-Feder, Dr. Alfons Meindl, Abteilung fur RefLoc Padiatrische Genetik Kinderpoliklinik, Klinikum Innenstadt RefLoc der Universitat, Munchen, Goethestrasse 29, D-80336 RefLoc Munchen, Germany. RefNumber [2] RefCrossRef MEDLINE; 98118357 RefAuthors Holinski-Feder, E., Weiss M., Brandau, O., Jedele, K. B., RefAuthors Nore, B., Beckesj", C.-M., Vihinen, M., G"tz, G., Hubbard, RefAuthors S. R., Belohradsky, B. H., Smith, C. I. E., Meindl, A. RefTitle Mutation screening of the btk gene in 56 families with RefTitle X-linked agammaglobulinemia (XLA) - 47 unique mutations RefTitle without correlation to clinical course RefLoc Pediatrics 101:276-284(1998) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68251 Feature /change: t -> g Feature /genomic_region: exon; 18 Feature /RE: +HaeIV, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 2009 Feature /codon: gta -> gga; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 626 Feature /change: V -> G Feature /domain: TK Symptoms classical XLA Sex XY Age 3 IgA < 0.07 IgG 1.04 IgM 0.34 CD19 1 Comment -!-Symptoms: recurrent airway infections // ID BTK_HUMAN; ;@T628X649; KQMSVPLSKFFX Occurrence 1/1 Accession K235 DBCrossRef BTKbase:A0157 Original code AJ; 14 Description frameshift insertion in the exon 18 leading to Description stop codon in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95359987 RefAuthors Gaspar, H. B., Bradley, L. A. D., Katz, F., Lovering, R. RefAuthors C., Roifman, C. M., Morgan, G., Levinsky, R. J., RefAuthors Kinnon, C. RefTitle Mutation analysis in Bruton's tyrosine kinase, the X- RefTitle linked agammaglobulinemia, including identification of an RefTitle insertional hotspot RefLoc Hum. Molec. Genet. 4: 755-757(1995) Feature dna; 1 Feature /rnalink: 2 Feature /name: insertion Feature /loc: EMBL: Hsu78027: 68255 Feature /change: +ca Feature /genomic_region: exon; 18 Feature /RE: +AauI, +AccI, +AfaI, +AlwNI, +BccI, +Bsp1407I, Feature /RE: +BsrGI, +BssNAI, +Bst1107I, +Bst4CI, +BstZ17I, +Cac8I, Feature /RE: +CaiI, +Csp6I, +FblI, +Hsp92II, +Hsp92II, +NlaIII, Feature /RE: +NlaIII, +RsaI, +SnaI, +SspBI, +TaaI, +TatI, Feature /RE: +Tsp4CI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: frameshift Feature /loc:EMBL: X58957; G312467; HSATK: 2013 Feature /note: generates MsI1 site Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 628..649 Feature /change: YTIMYSCWHE KADERPTFKI LLS -> IPSCTVVGMR Feature /change: KQMSVPLSKF FX Feature /domain: TK Protein struct premature stop Symptoms classical XLA Sex XY Family history de novo B cells surf Ig <1 // ID BTK_HUMAN; ;@I629X653; unknown Occurrence 1/1 Accession K236 DBCrossRef BTKbase:A0066 Original code 14 Description frameshift insertion in the exon 18 leading to Description stop codon in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 3) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95152522 RefAuthors Zhu, Q., Zhang, M., Winkelstein, J., Chen., S., Ochs, H.D. RefTitle Unique mutations of Bruton's tyrosine kinase in fourteen RefTitle unrelated X-linked agammaglobulinemia families RefLoc Hum. Molec. Genet. 3:1899-1900(1994) Feature dna; 1 Feature /rnalink: 2 Feature /name: insertion Feature /loc: EMBL: Hsu78027: unknown Feature /changeLength: +26 bp Feature /genomic_region: unknown Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: frameshift Feature /loc: EMBL: X58957; G312467; HSATK: 2019 Feature /codon: unknown Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature stop Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 629 Feature /change: unknown Feature /domain: TK Protein struct premature stop Symptoms classical XLA Sex XY Family history inherited // ID BTK_HUMAN; ;#629-4+1; TIMYSCTS Occurrence 1/1 Accession K237 DBCrossRef BTKbase:A0514 Original code 2390 Description In-frame deletion and insertion in the exon 18 Date 14-Oct-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 98213565 RefAuthors Conley, M. E., Mathias, D., Treadaway, J., Minegishi, RefAuthors Y., Rohrer, J. RefTitle Mutations in Btk patients with presumed X-linked RefTitle agammaglobulinemia RefLoc Am J. Hum. Genet. 62:1034-1043(1998) Feature dna; 1 Feature /rnalink; 3 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 68258..68274 Feature /change: -catcatgtacagttgt Feature /genomic_region: exon; 18 Feature dna; 2 Feature /rnalink; 3 Feature /name: insertion Feature /loc: EMBL: Hsu78027: 68258 Feature /change: +ttcg Feature /genomic_region: exon;18 Feature /RE: +AauI, +AfaI, +AlwNI, +Bsp1407I, +BsrGI, +Bst4CI, Feature /RE: +Cac8I, +CaiI, +Csp6I, +Hsp92II, +Hsp92II, +NlaIII, Feature /RE: +NlaIII, +RsaI, +SfaNI, +SspBI, +TaaI, +TatI, Feature /RE: +Tsp4CI, Feature rna; 3 Feature /dnalink; 1 Feature /dnalink; 2 Feature /aalink; 4 Feature /name: inframe deletion Feature /loc: EMBL: X58957; G312467; HSATK: 2016..2031 Feature /codon: acc -> a; 3 Feature aa; 4 Feature /rnalink: 3 Feature /name: inframe deletion Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 628..633 Feature /change: TIMYSC -> TS Feature /domain: TK Symptoms classical XLA Sex XY Family history inherited // ID BTK_HUMAN; ;M630K; MK Occurrence 1/1 Accession K238 DBCrossRef BTKbase:A0076 Original code 236 Description missense mutation in the exon 18 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95152493 RefAuthors Hagemann, T. L., Chen, Y., Rosen, F. S., Kwan, S. RefTitle Genomic organization of the Btk gene and exon scanning for RefTitle mutations in the patients with X-linked RefTitle agammaglobulinemia RefLoc Hum. Molec. Genet. 3:1743-1749(1994) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef OMIM; 300300.0048 DB CrossRef SWISSCHANGE; BTK_HUMAN_68 DB CrossRef SWISS-PROT; Q06187:630_630 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68263 Feature /change: t -> a Feature /genomic_region: exon; 18 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 2021 Feature /codon: atg -> aag; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 630 Feature /change: M -> K Feature /domain: TK Protein struct destabilization of hydrophobic core; ref [2] Symptoms classical XLA Sex XY Family history inherited IgA hd IgE hd IgG < 10% IgM hd B cells surf Ig nd // ID BTK_HUMAN; ;M630K; MK Occurrence 1/1 Accession K239 DBCrossRef BTKbase:A0099 Original code 24 Description missense mutation in the exon 18 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95152494 RefAuthors Conley, M. E., Fitch-Hilgenberg, M. E., Cleveland, J. L. RefAuthors Parolini, O., Rohrer, J. RefTitle Screening of genomic DNA to indentify mutations in the RefTitle gene for Bruton's tyrosine kinase RefLoc Hum. Molec. Genet. 3: 1751-1756(1994) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef OMIM; 300300.0048 DB CrossRef SWISSCHANGE; BTK_HUMAN_68 DB CrossRef SWISS-PROT; Q06187:630_630 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68263 Feature /change: t -> a Feature /genomic_region: exon; 18 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 2021 Feature /codon: atg -> aag; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 630 Feature /change: M -> K Feature /domain: TK Protein struct destabilization of hydrophobic core; ref [2] Symptoms classical XLA Sex XY Family history inherited B cells surf Ig <1 // ID BTK_HUMAN; ;M630T; MT Occurrence 1/1 Accession K240 DBCrossRef BTKbase:A0439 Original code G8672 Description missense mutation in the exon 18 leading to Description amino acid change in TK domain Date 07-Sep-1997 (Rel. 5, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (07-Sep-1997) to the BTKbase. RefLoc Dr. Tracy Lester, Unit of Clinical Genetics, Institute RefLoc of Child Health, 30 Guilford Street, London, WC1N 1EH, RefLoc Tel 0171 242 9789 ext 2284, Fax 0171 404 6191 RefLoc e-mail T.Lester@ich.ucl.ac.uk Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68263 Feature /change: t -> c Feature /genomic_region: exon; 18 Feature /RE: +BsaAI, +BstBAI, +MaeII, +TaiI, +TscI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 2021 Feature /note: destroys Nla III site Feature /note: generates Tai I site Feature /note: generates Mae II site Feature /codon: atg -> acg; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 630 Feature /change: M -> T Feature /domain: TK Symptoms classical XLA Sex XY Ethnic origin Caucasoid; England Family history de novo CD19 1 Comment -!-Family history: mother does not carry mutation // ID BTK_HUMAN; ;#Y631X; YX Occurrence 1/1 Accession K241 DBCrossRef BTKbase:A0440 Original code G13557 Description frameshift deletion in the exon 18 leading to Description stop codon in TK domain Date 07-Sep-1997 (Rel. 5, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (07-Sep-1997) to the BTKbase. RefLoc Dr. Tracy Lester, Unit of Clinical Genetics, Institute RefLoc of Child Health, 30 Guilford Street, London, WC1N 1EH, RefLoc Tel 0171 242 9789 ext 2284, Fax 0171 404 6191 RefLoc e-mail T.Lester@ich.ucl.ac.uk Feature dna; 1 Feature /rnalink: 2 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 68266..68267 Feature /change: -ac Feature /genomic_region: exon; 18 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: frameshift Feature /loc:EMBL: X58957; G312467; HSATK: 2024..2025 Feature /note: destroys RsaI site Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 631 Feature /change: Y -> X Feature /domain: TK Protein struct premature stop Symptoms classical XLA Sex XY Ethnic origin Caucasoid; England Family history de novo CD19 0 Comment -!-Family history: mother does not carry mutation // ID BTK_HUMAN; ;#Y631X648; YTVVGMRKRMSVPLSKFFX Occurrence 1/1 Accession K242 DBCrossRef BTKbase:A0137 Original code 57; TAX Description frameshift deletion in the exon 18 leading to Description stop codon in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95359977 RefAuthors Jin, H., Webster, A. D. B., Vihinen, M., Sideras, P., RefAuthors Vorechovsky, I., Hammarstrom, L., RefAuthors Bernatowska-Matuszkiewicz, E., Smith, C. I. E., Bobrow, M., RefAuthors Vetrie, D. RefTitle Identification of Btk mutations in 20 unrelated patients RefTitle with X-linked agammaglobulinemia (XLA) RefLoc Hum. Molec. Genet. 4: 693-700(1995) Feature dna; 1 Feature /rnalink: 2 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 68265 Feature /change: -t Feature /genomic_region: exon; 18 Feature /RE: +Bsp24I, +BspHI, +CjePI, +Hpy178III, +PagI, +RcaI, Feature /RE: Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: frameshift Feature /loc:EMBL: X58957; G312467; HSATK: 2023 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 631 Feature /change: Y -> TVVGMRKRMS VPLSKFFX Feature /domain: TK Protein struct premature stop Symptoms classical XLA Sex XY Family history de novo B cells surf Ig <1 // ID BTK_HUMAN; ;#S632X648; SVVGMRKQMSVPLSKFFX Occurrence 1/1 Accession K243 DBCrossRef BTKbase:A0138 Original code 17 Description frameshift deletion in the exon 18 leading to Description stop codon in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95359977 RefAuthors Jin, H., Webster, A. D. B., Vihinen, M., Sideras, P., RefAuthors Vorechovsky, I., Hammarstrom, L., RefAuthors Bernatowska-Matuszkiewicz, E., Smith, C. I. E., Bobrow, M., RefAuthors Vetrie, D. RefTitle Identification of Btk mutations in 20 unrelated patients RefTitle with X-linked agammaglobulinemia (XLA) RefLoc Hum. Molec. Genet. 4: 693-700(1995) Feature dna; 1 Feature /rnalink: 2 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 68268 Feature /change: -a Feature /genomic_region: exon; 18 Feature /RE: +MaeII, +TaiI, +TscI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: frameshift Feature /loc:EMBL: X58957; G312467; HSATK: 2026 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 632 Feature /change: S -> VVGMRKQMSV PLSKFFX Feature /domain: TK Protein struct premature stop Symptoms classical XLA Sex XY Age 1 Family history inherited IgA < 0.2 IgG < 1 IgM < 0.2 B cells surf Ig 2 // ID BTK_HUMAN; ;C633Y; CY Occurrence 1/1 Accession K244 DBCrossRef BTKbase:A0320 Original code P16 Description missense mutation in the exon 18 leading to Description amino acid change in TK domain Date 14-Aug-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 96289505 RefAuthors Hashimoto, S., Tsukada, S., Matsushita, M., Miyawaki, T., RefAuthors Niida, Y., Yachie, A., Kobayashi, S., Iwata, T., RefAuthors Hayakawa, H., Matsuoka, H., Tsuge, I., Yamadori, T., RefAuthors Kunikata, T., Arai, S., Yoshizaki, K., Taniguchi, N., RefAuthors Kishimoto, T. RefTitle Identification of Bruton's tyrosine kinase (Btk) gene RefTitle mutations and characterization of the derived proteins in RefTitle 35 X-linked agammaglobulinemia families: a nationwide RefTitle study of Btk deficiency in Japan RefLoc Blood 88:561-573(1996) DB CrossRef SWISSCHANGE; BTK_HUMAN_69 DB CrossRef SWISS-PROT; Q06187:633_633 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68272 Feature /change: g -> a Feature /genomic_region: exon; 18 Feature /RE: +Bse1I, +BseNI, +BsrI, +BsrSI, +MaeIII, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 2030 Feature /codon: tgt -> tat; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 633 Feature /change: C -> Y Feature /domain: TK Kinase activity inactive Sex XY Age 5 Ethnic origin Mongoloid; Japan Family history inherited IgA 0.10 IgG 1.30 IgM 0.24 B cells surf Ig <0.1 // ID BTK_HUMAN; ;W634X; WX Occurrence 1/1 Accession K245 DBCrossRef BTKbase:A0321 Original code P27 Description nonsense mutation in the exon 18 leading to Description stop codon in TK domain Date 19-Aug-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 3) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 96289505 RefAuthors Hashimoto, S., Tsukada, S., Matsushita, M., Miyawaki, T., RefAuthors Niida, Y., Yachie, A., Kobayashi, S., Iwata, T., RefAuthors Hayakawa, H., Matsuoka, H., Tsuge, I., Yamadori, T., RefAuthors Kunikata, T., Arai, S., Yoshizaki, K., Taniguchi, N., RefAuthors Kishimoto, T. RefTitle Identification of Bruton's tyrosine kinase (Btk) gene RefTitle mutations and characterization of the derived proteins in RefTitle 35 X-linked agammaglobulinemia families: a nationwide RefTitle study of Btk deficiency in Japan RefLoc Blood 88:561-573(1996) RefNumber [2] RefCrossRef MEDLINE; 98102441 RefAuthors Futatani, T., Miyawaki, T., Tsukada, S., Hashimoto, S., RefAuthors Kunikata, T., Arai, S., Kurimoto, T., Niida, Y., Matsuoka, RefAuthors H., Sakiyama, Y., Iwata, T., Tsuchiya, S., Tatsuzawa, O., RefAuthors Yoshizaki, K., Kishimoto, T. RefTitle Deficient expression of Bruton's tyrosine kinase in RefTitle monocytes from X-linked agammaglobulinemia as evaulated by RefTitle a flow cytometric analysis and its clinical application to RefTitle carrier detection RefLoc Blood 91:595-602(1998) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68276 Feature /change: g -> a Feature /genomic_region: exon; 18 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 2034 Feature /codon: tgg -> tga; 3 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 634 Feature /change: W -> X Feature /domain: TK Protein level absent; ref [2] Kinase activity inactive; ref [2] Sex XY Age 2.42 Ethnic origin Mongoloid; Japan Family history inherited IgA 0.10 IgG 0.40 IgM 0.15 B cells surf Ig 0.3 Comment -!-Symptoms: agranulocytosis // ID BTK_HUMAN; ;E636X; EX Occurrence 3/3 Accession K246 DBCrossRef BTKbase:A0019 Original code AP Description nonsense mutation in the exon 18 leading to Description stop codon in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 94214481 RefAuthors Bradley, L.A.D., Sweatman, A.K., Lovering, R.C., Jones, RefAuthors A.M., Morgan, G., Levinsky, R.J., Kinnon, C. RefTitle Mutation detection in the X-linked agammaglobulinemia RefTitle gene, BTK, using single strand conformation polymorphism RefTitle analysis RefLoc Hum. Molec. Genet. 3:79-83(1994) DB CrossRef OMIM; 300300.0049 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68280 Feature /change: g -> t Feature /genomic_region: exon; 18 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: nonsense Feature /loc: EMBL: X58957; G312467; HSATK: 2038 Feature /note: destroys NlaIII site Feature /codon: gag -> tag; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 636 Feature /change: E -> X Feature /domain: TK Protein struct premature stop Symptoms classical XLA Sex XY Family history inherited Relative BTK; A0020; brother Relative BTK; A0021; brother IgA 1.0 IgG 1.2 IgM 5.2 B cells surf Ig <1 // ID BTK_HUMAN; ;@K637X638; KAPX Occurrence 1/1 Accession K249 DBCrossRef BTKbase:A0027 Original code G03 Description frameshift insertion in the exon 19 leading to Description stop codon in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 94214435 RefAuthors de Weers, M., Mensink, R. G. J., Kraakman, M. E. M., RefAuthors Schuurman, R. K. B., Hendriks, R. W. RefTitle Mutation analysis of the Bruton's tyrosine kinase gene in RefTitle X-linked agammaglobulinemia: identification of a mutation RefTitle which affects the same codon as is altered in RefTitle immunodeficient xid mice RefLoc Hum. Molec. Genet. 3:161-166(1994) DB CrossRef OMIM; 300300.0050 Feature dna; 1 Feature /rnalink: 2 Feature /name: insertion Feature /loc: EMBL: Hsu78027: 71521 Feature /change: + ttttag Feature /genomic_region: exon; 19 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: frameshift Feature /loc: EMBL: X58957; G312467; HSATK: 2041 Feature /note: possibly defective splicing exon 18 to 19 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 637..638 Feature /change: KA -> PX Feature /domain: TK Protein struct premature stop Symptoms classical XLA Sex XY Age 3 Family history inherited IgA 0.03 IgG 0.06 IgM 0.06 // ID BTK_HUMAN; ;R641C; RC Occurrence 1/1 Accession K250 DBCrossRef BTKbase:A0158 Original code 15 Description missense mutation in the exon 19 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95359987 RefAuthors Gaspar, H. B., Bradley, L. A. D., Katz, F., Lovering, R. RefAuthors C., Roifman, C. M., Morgan, G., Levinsky, R. J., RefAuthors Kinnon, C. RefTitle Mutation analysis in Bruton's tyrosine kinase, the X- RefTitle linked agammaglobulinemia, including identification of an RefTitle insertional hotspot RefLoc Hum. Molec. Genet. 4: 755-757(1995) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_71 DB CrossRef SWISS-PROT; Q06187:641_641 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 71533 Feature /change: c -> t Feature /CpG; 1 Feature /genomic_region: exon; 19 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 2053 Feature /codon: cgt -> tgt; 1 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 641 Feature /change: R -> C Feature /domain: TK Protein struct destroys stabilizing ion bond with E567; ref [2] Symptoms classical XLA Sex XY Family history inherited // ID BTK_HUMAN; ;R641H; RH Occurrence 1/1 Accession K251 DBCrossRef BTKbase:A0139 Original code 23 Description missense mutation in the exon 19 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95359977 RefAuthors Jin, H., Webster, A. D. B., Vihinen, M., Sideras, P., RefAuthors Vorechovsky, I., Hammarstrom, L., RefAuthors Bernatowska-Matuszkiewicz, E., Smith, C. I. E., Bobrow, M., RefAuthors Vetrie, D. RefTitle Identification of Btk mutations in 20 unrelated patients RefTitle with X-linked agammaglobulinemia (XLA) RefLoc Hum. Molec. Genet. 4: 693-700(1995) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_72 DB CrossRef SWISS-PROT; Q06187:641_641 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 71534 Feature /change: g -> a Feature /CpG; 2 Feature /genomic_region: exon; 19 Feature /RE: +BsaBI, +Bse8I, +Bsh1365I, +BsiBI, +BsrBRI, +MamI, Feature /RE: +SfaNI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 2054 Feature /codon: cgt -> cat; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 641 Feature /change: R -> H Feature /domain: TK Protein struct destroys stabilizing ion bond with E567; ref [2] Symptoms mild XLA Sex XY Age <1 Family history inherited IgA < 0.3 IgG 1.2 IgM 0.27 B cells surf Ig <1 // ID BTK_HUMAN; ;R641H; RH Occurrence 1/1 Accession K252 DBCrossRef BTKbase:A0140 Original code 35 Description missense mutation in the exon 19 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95359977 RefAuthors Jin, H., Webster, A. D. B., Vihinen, M., Sideras, P., RefAuthors Vorechovsky, I., Hammarstrom, L., RefAuthors Bernatowska-Matuszkiewicz, E., Smith, C. I. E., Bobrow, M., RefAuthors Vetrie, D. RefTitle Identification of Btk mutations in 20 unrelated patients RefTitle with X-linked agammaglobulinemia (XLA) RefLoc Hum. Molec. Genet. 4: 693-700(1995) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_72 DB CrossRef SWISS-PROT; Q06187:641_641 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 71534 Feature /change: g -> a Feature /CpG; 2 Feature /genomic_region: exon; 19 Feature /RE: +BsaBI, +Bse8I, +Bsh1365I, +BsiBI, +BsrBRI, +MamI, Feature /RE: +SfaNI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 2054 Feature /codon: cgt -> cat; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 641 Feature /change: R -> H Feature /domain: TK Protein struct destroys stabilizing ion bond with E567; ref [2] Symptoms classical XLA Sex XY Age 1 Family history de novo IgA < 0.1 IgG 2.0 IgM 0.2 B cells surf Ig <1 // ID BTK_HUMAN; ;R641H; RH Occurrence 1/1 Accession K253 DBCrossRef BTKbase:A0141 Original code 20 Description missense mutation in the exon 19 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95359977 RefAuthors Jin, H., Webster, A. D. B., Vihinen, M., Sideras, P., RefAuthors Vorechovsky, I., Hammarstrom, L., RefAuthors Bernatowska-Matuszkiewicz, E., Smith, C. I. E., Bobrow, M., RefAuthors Vetrie, D. RefTitle Identification of Btk mutations in 20 unrelated patients RefTitle with X-linked agammaglobulinemia (XLA) RefLoc Hum. Molec. Genet. 4: 693-700(1995) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_72 DB CrossRef SWISS-PROT; Q06187:641_641 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 71534 Feature /change: g -> a Feature /CpG; 2 Feature /genomic_region: exon; 19 Feature /RE: +BsaBI, +Bse8I, +Bsh1365I, +BsiBI, +BsrBRI, +MamI, Feature /RE: +SfaNI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 2054 Feature /codon: cgt -> cat; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 641 Feature /change: R -> H Feature /domain: TK Protein struct destroys stabilizing ion bond with E567; ref [2] Symptoms classical XLA Sex XY Age 3 Family history inherited B cells surf Ig <1 // ID BTK_HUMAN; ;R641H; RH Occurrence 1/1 Accession K254 DBCrossRef BTKbase:A0403 Original code I Description missense mutation in the exon 19 leading to Description amino acid change in TK domain Date 02-Jan-1997 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (01-Jan-1997) to the BTKbase. RefLoc Dr. C.I.E. Smith, Center for BioTechnology, Department of RefLoc Biosciences at Novum, Karolinska Institute, S-14157 RefLoc Huddinge, Sweden, e-mail edvard.smith@cbt.ki.se DB CrossRef SWISSCHANGE; BTK_HUMAN_72 DB CrossRef SWISS-PROT; Q06187:641_641 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 71534 Feature /change: g -> a Feature /CpG; 2 Feature /genomic_region: exon; 19 Feature /RE: +BsaBI, +Bse8I, +Bsh1365I, +BsiBI, +BsrBRI, +MamI, Feature /RE: +SfaNI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 2054 Feature /codon: cgt -> cat; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 641 Feature /change: R -> H Feature /domain: TK Sex XY // ID BTK_HUMAN; ;R641H; RH Occurrence 1/1 Accession K255 DBCrossRef BTKbase:A0454 Original code PS Description missense mutation in the exon 19 leading to Description amino acid change in TK domain Date 22-Sep-1997 (Rel. 5, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (22-Sep-1997) to the BTKbase. RefLoc Dr. Hans D. Ochs, Dept of Pediatrics, University of RefLoc Washington, Seattle, WA 98195, USA, RefLoc e-mail allgau@u.washington.edu. DB CrossRef SWISSCHANGE; BTK_HUMAN_72 DB CrossRef SWISS-PROT; Q06187:641_641 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 71534 Feature /change: g -> a Feature /CpG; 2 Feature /genomic_region: exon; 19 Feature /RE: +BsaBI, +Bse8I, +Bsh1365I, +BsiBI, +BsrBRI, +MamI, Feature /RE: +SfaNI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 2054 Feature /codon: cgt -> cat; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 641 Feature /change: R -> H Feature /domain: TK Sex XY // ID BTK_HUMAN; ;R641H; RH Occurrence 1/1 Accession K256 DBCrossRef BTKbase:A0455 Original code AH Description missense mutation in the exon 19 leading to Description amino acid change in TK domain Date 22-Sep-1997 (Rel. 5, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (22-Sep-1997) to the BTKbase. RefLoc Dr. Hans D. Ochs, Dept of Pediatrics, University of RefLoc Washington, Seattle, WA 98195, USA, RefLoc e-mail allgau@u.washington.edu. DB CrossRef SWISSCHANGE; BTK_HUMAN_72 DB CrossRef SWISS-PROT; Q06187:641_641 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 71534 Feature /change: g -> a Feature /CpG; 2 Feature /genomic_region: exon; 19 Feature /RE: +BsaBI, +Bse8I, +Bsh1365I, +BsiBI, +BsrBRI, +MamI, Feature /RE: +SfaNI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 2054 Feature /codon: cgt -> cat; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 641 Feature /change: R -> H Feature /domain: TK Sex XY // ID BTK_HUMAN; ;#P642X654; PTFQNSSEQYSRCHG* Occurrence 1/1 Accession K257 DBCrossRef BTKbase:A0513 Original code IV Description deletion in the exon 19 Date 13-Oct-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Dr. Igor Resnick, Department of Clinical Immunology, RefLoc Research Institute for Paediatric Hematology, RefLoc Central Republican Paediatric Hospital, RefLoc Leninsky Pr. 117, Moscow 117513, Russia. RefLoc Submitted (10-Oct-1998) to BTKbase. Feature dna; 1 Feature /rnalink; 2 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 71537 Feature /change: ccactttc -> Feature /genomic_region: exon;19 Feature rna; 2 Feature /dnalink; 1 Feature /aalink; 3 Feature /name: frameshift Feature /loc: EMBL: X58957; G312467; HSATK: 2057..2064 Feature /codon: ccc -> -; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: out-of-frame extension Feature /loc: SWISS-PROT: Q06187; BTK_HUMAN: 642..644 Feature /change: PTF -> QNSSEQYSRCHG* Feature /domain: TK Sex XY IgA < 6.67 IgG 116 IgM 20.8 CD19 1 Comment -!-Symptoms: necrotic mucosis, recurrent bronchitis, Comment purulent otitis, purulent rhinitis, purulent sinusitis // ID BTK_HUMAN; ;F644L; FL Occurrence 1/1 Accession K258 DBCrossRef BTKbase:A0441 Original code G12738 Description missense mutation in the exon 19 leading to Description amino acid change in TK domain Date 07-Sep-1997 (Rel. 5, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (07-Sep-1997) to the BTKbase. RefLoc Dr. Tracy Lester, Unit of Clinical Genetics, Institute RefLoc of Child Health, 30 Guilford Street, London, WC1N 1EH, RefLoc Tel 0171 242 9789 ext 2284, Fax 0171 404 6191 RefLoc e-mail T.Lester@ich.ucl.ac.uk Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 71544 Feature /change: c -> a Feature /genomic_region: exon; 19 Feature /RE: +AhaIII, +DraI, +MseI, +Tru1I, +Tru9I, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 2064 Feature /codon: ttc -> tta; 3 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 644 Feature /change: F -> L Feature /domain: TK Symptoms classical XLA Sex XY Ethnic origin Caucasoid; Northern Ireland Family history de novo CD19 0 Comment -!-Family history: mother does not carry mutation // ID BTK_HUMAN; ;F644S; FS Occurrence 1/1 Accession K259 DBCrossRef BTKbase:A0322 Original code P14 Description missense mutation in the exon 19 leading to Description amino acid change in TK domain Date 14-Aug-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 3) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 96289505 RefAuthors Hashimoto, S., Tsukada, S., Matsushita, M., Miyawaki, T., RefAuthors Niida, Y., Yachie, A., Kobayashi, S., Iwata, T., RefAuthors Hayakawa, H., Matsuoka, H., Tsuge, I., Yamadori, T., RefAuthors Kunikata, T., Arai, S., Yoshizaki, K., Taniguchi, N., RefAuthors Kishimoto, T. RefTitle Identification of Bruton's tyrosine kinase (Btk) gene RefTitle mutations and characterization of the derived proteins in RefTitle 35 X-linked agammaglobulinemia families: a nationwide RefTitle study of Btk deficiency in Japan RefLoc Blood 88:561-573(1996) RefNumber [2] RefCrossRef MEDLINE; 98102441 RefAuthors Futatani, T., Miyawaki, T., Tsukada, S., Hashimoto, S., RefAuthors Kunikata, T., Arai, S., Kurimoto, T., Niida, Y., Matsuoka, RefAuthors H., Sakiyama, Y., Iwata, T., Tsuchiya, S., Tatsuzawa, O., RefAuthors Yoshizaki, K., Kishimoto, T. RefTitle Deficient expression of Bruton's tyrosine kinase in RefTitle monocytes from X-linked agammaglobulinemia as evaulated by RefTitle a flow cytometric analysis and its clinical application to RefTitle carrier detection RefLoc Blood 91:595-602(1998) DB CrossRef SWISSCHANGE; BTK_HUMAN_73 DB CrossRef SWISS-PROT; Q06187:644_644 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 71543 Feature /change: t -> c Feature /genomic_region: exon; 19 Feature /RE: +CjePI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 2063 Feature /codon: ttc -> tcc; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 644 Feature /change: F -> S Feature /domain: TK Protein level much reduced; ref [2] Kinase activity inactive; ref [2] Sex XY Age 0.25 Ethnic origin Mongoloid; Japan Family history inherited IgA 0.29 IgM 0.17 B cells surf Ig 0.6 Comment -!-Family history: two affected brothers // ID BTK_HUMAN; ;L647R; LR Occurrence 3/3 Accession K260 DBCrossRef BTKbase:A0202 Original code L647P(1); L647R(1) Description missense mutation in the exon 19 leading to Description amino acid change in TK domain Date 25-Sep-1995 (Rel. 2, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 3) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (08-Sept-1995) to the BTKbase. RefLoc Dr. Hans D. Ochs, Dept of Pediatrics, University of RefLoc Washington, Seattle, WA 98195, USA, RefLoc e-mail allgau@u.washington.edu. RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef SWISSCHANGE; BTK_HUMAN_74 DB CrossRef SWISS-PROT; Q06187:647_647 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 71552 Feature /change: t -> g Feature /genomic_region: exon; 19 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 2072 Feature /codon: ctt -> cgt; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 647 Feature /change: L -> R Feature /domain: TK Protein struct affects conformation of the C-terminus; ref [2] Sex XY Family history inherited Relative BTK; A0460; brother Relative BTK; A0461; uncle // ID BTK_HUMAN; ;#I651X652; IIX Occurrence 1/1 Accession K263 DBCrossRef BTKbase:A0124 Original code 6/26 Description frameshift deletion in the exon 19 leading to Description stop codon in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95227177 RefAuthors Vorechovsky, I., Vihinen, M., de Saint Basile, G., RefAuthors Honsova, S., Hammarstrom, L., Muller, S., Nilsson, L., RefAuthors Fischer, A., Smith, C. I. E. RefTitle DNA-based mutation analysis of Bruton's tyrosine gene RefTitle in patients with X-linked agammaglobulinemia RefLoc Hum. Molec. Genet. 4:51-58(1995) Feature dna; 1 Feature /rnalink: 2 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 71564 Feature /change: -t Feature /genomic_region: exon; 19 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: frameshift Feature /loc:EMBL: X58957; G312467; HSATK: 2084 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 651 Feature /change: I -> IX Feature /domain: TK Protein struct premature stop Sex XY Family history inherited // ID BTK_HUMAN; ;L652P; LP Occurrence 1/1 Accession K264 DBCrossRef BTKbase:A0100 Original code 25 Description missense mutation in the exon 19 leading to Description amino acid change in TK domain Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95152494 RefAuthors Conley, M. E., Fitch-Hilgenberg, M. E., Cleveland, J. L. RefAuthors Parolini, O., Rohrer, J. RefTitle Screening of genomic DNA to indentify mutations in the RefTitle gene for Bruton's tyrosine kinase RefLoc Hum. Molec. Genet. 3: 1751-1756(1994) RefNumber [2] RefCrossRef MEDLINE; 95108046 RefAuthors Vihinen, M., Vetrie, D., Maniar, H. S., Ochs, H. D., Zhu, RefAuthors Q., Vorechovsky, I., Webster, A. D. B., Notarangelo, L. D., RefAuthors Nilsson, L., Sowadski, J. M., Smith, C. I. E. RefTitle Structural basis for chromosome X-linked RefTitle agammaglobulinemia: A tyrosine kinase disease RefLoc Proc. Natl. Acad. Sci. U.S.A. 91:12803-12807(1994) DB CrossRef OMIM; 300300.0051 DB CrossRef SWISSCHANGE; BTK_HUMAN_70 DB CrossRef SWISS-PROT; Q06187:652_652 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 71567 Feature /change: t -> c Feature /genomic_region: exon; 19 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: missense Feature /loc: EMBL: X58957; G312467; HSATK: 2087 Feature /codon: cta -> cca; 2 Feature aa; 3 Feature /rnalink: 2 Feature /name: aa substitution Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 652 Feature /change: L -> P Feature /domain: TK Protein struct domain-domain interactions; ref [2] Symptoms classical XLA Sex XY Family history inherited B cells surf Ig <1 // ID BTK_HUMAN; ;Intron 8; ga Occurrence 1/1 Accession K265 DBCrossRef BTKbase:A0248 Original code 41 Description a point mutation at intron 8 leading to aberrant splicing Date 02-Feb-1996 (Rel. 3, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 6) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 97288998 RefAuthors Vorechovsky, I., Luo, L., Hertz., J. M., Froland, S. S., RefAuthors Fiorini, N., Quinti, I., Paganelli, R., Segers, R., RefAuthors Hammarstrom, L., Webster, A. D. B., Smith, C. I. E. RefTitle Mutation pattern in the Bruton's tyrosine kinase gene in RefTitle 26 unrelated patients with X-linked agammaglobulinemia RefLoc Hum. Mut. 9:418-425 (1997) DB CrossRef ESID; FI 0003 M81 G1 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 60908 Feature /change: g -> a Feature /genomic_region: intron; 8 Feature /RE: +BseGI, +BstF5I, +FokI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: unknown Feature /inexloc:+1 Feature aa; 3 Feature /rnalink: 2 Feature /name: unknown Feature /domain: PH mRNA level nd Sex XY Family history inherited // ID BTK_HUMAN; ;Intron 13; SLSTWPMAASX Occurrence 2/2 Accession K266 DBCrossRef BTKbase:A0173 Original code WKZ-5a Description point mutation at intron 13 leading to stop codon in TK Description domain and a large deletion of protein. Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (15-May-1995) to the BTKbase. RefLoc Dr. Rik A. Brooimans, Wilhelmina Kinderziekenhuis, RefLoc Postbus 18009,3501 CA Utrecht, The Netherlands, RefLoc e-mail R.Brooimans@wkz.ruu.nl. Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 64518 Feature /change: a -> t Feature /genomic_region: intron; 13 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: loss of exon sequence; frameshift Feature /loc: EMBL: X58957; G312467; HSATK: 1178..1349 Feature /change: - gatcatggga aattgatcca aaggacctga ccttcttgaa Feature /change: ggagctgggg actggacaat ttggggtagt gaagtatggg Feature /change: aaatggagag gccagtacga cgtggccatc aagatgatca Feature /change: aagaaggctc catgtctgaa gatgaattca ttgaagaagc Feature /change: caaagtcatg at Feature /note: deletion of exon 14 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 384 Feature /change: A -> GSWEIDPKDL TFLKELGTGQ FGVVKYGKWR GQYDVAIKMI Feature /change: KEGSMSEDEF IEEAKVMIIF PMRSWCSCMA SAPSSAPSSS Feature /change: SLSTWPMAAS X Feature /domain: TK Protein struct premature stop Symptoms classical XLA Sex XY Age 4 Family history inherited Relative BTK; A0174; brother IgA nd IgG 1.1 IgM 0.1 B cells surf Ig <1 // ID BTK_HUMAN; ;Intron 13; GSWEIDPKDLTGNSLFLSDHGKLIQRTX Occurrence 2/2 Accession K268 DBCrossRef BTKbase:A0277 Original code WKZ-10(a) Description deletion at intron 13 Date 22-Apr-1996 (Rel. 3, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (22-Apr-1996) to the BTKbase. RefLoc Dr. Rik A. Brooimans, Wilhelmina Kinderziekenhuis, RefLoc Postbus 18009,3501 CA Utrecht, The Netherlands, RefLoc e-mail R.Brooimans@wkz.ruu.nl. RefNumber [2] RefCrossRef MEDLINE; 97335603 RefAuthors Brooimans, R.A., van den Berg, J.A.M., Rijkers, G.T., RefAuthors Sanders, L.A.M., van Amstel, J.K.P., Tilanus, M.G.J., RefAuthors Grubben, M.J.A.L., Zegers, B.J.M. RefTitle Identification of novel Bruton's tyrosine kinase mutations RefTitle in 10 unrelated subjects with X linked agammaglobulinemia RefLoc J. Med. Genet. 34: 484-488(1997) Feature dna; 1 Feature /rnalink: 2 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 63968 Feature /change: -t Feature /genomic_region: intron; 13 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /loc: EMBL: X58957; G312467; HSATK: 1310 Feature /name: gain of exon sequence; frameshift Feature /change: + gtaactcctt atttctctgg Feature /inexloc: +2 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 393..403 Feature /change: GSWEIDPKDLT -> GNSLFLSDHGKLIQRTX Feature /domain: TK Symptoms classical XLA Sex XY Age 2 Family history inherited Relative BTK; A0278; nephew IgA 0.06 IgG 0.8 IgM 0.09 B cells surf Ig <1 // ID BTK_HUMAN; ;Intron 14; gt Occurrence 1/1 Accession K270 DBCrossRef BTKbase:A0389 Description point mutation at intron 14 leading to aberrant splicing Date 15-May-1997 (Rel. 5, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (27-Aug-1996) to the BTKbase. RefLoc Dr. Michael Weiss, prof. Dr. Bernd H. Belohradsky, RefLoc Abteilung fur Infektionsimmunologia, Dr. von Haunersches RefLoc Kinderspital Klinikum Innenstadt der Universitat, Munchen, RefLoc Lindwurmstrasse 4, D-80337 Munchen, Germany, RefLoc FAX 498 951 604 928. RefLoc Dr. Elke Holinski-Feder, Dr. Alfons Meindl, Abteilung fur RefLoc Padiatrische Genetik Kinderpoliklinik, Klinikum Innenstadt RefLoc der Universitat, Munchen, Goethestrasse 29, D-80336 RefLoc Munchen, Germany. RefNumber [2] RefCrossRef MEDLINE; 98118357 RefAuthors Holinski-Feder, E., Weiss M., Brandau, O., Jedele, K. B., RefAuthors Nore, B., Beckesj", C.-M., Vihinen, M., G"tz, G., Hubbard, RefAuthors S. R., Belohradsky, B. H., Smith, C. I. E., Meindl, A. RefTitle Mutation screening of the btk gene in 56 families with RefTitle X-linked agammaglobulinemia (XLA) - 47 unique mutations RefTitle without correlation to clinical course RefLoc Pediatrics 101:276-284(1998) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 64696 Feature /change: g -> t Feature /genomic_region: intron; 14 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: unknown Feature /inexloc:+5 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /domain: PH Sex XY // ID BTK_HUMAN; ;Intron 14; ga Occurrence 1/1 Accession K271 DBCrossRef BTKbase:A0390 Description point mutation at intron 14 leading to aberrant splicing Date 15-May-1997 (Rel. 5, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (27-Aug-1996) to the BTKbase. RefLoc Dr. Michael Weiss, prof. Dr. Bernd H. Belohradsky, RefLoc Abteilung fur Infektionsimmunologia, Dr. von Haunersches RefLoc Kinderspital Klinikum Innenstadt der Universitat, Munchen, RefLoc Lindwurmstrasse 4, D-80337 Munchen, Germany, RefLoc FAX 498 951 604 928. RefLoc Dr. Elke Holinski-Feder, Dr. Alfons Meindl, Abteilung fur RefLoc Padiatrische Genetik Kinderpoliklinik, Klinikum Innenstadt RefLoc der Universitat, Munchen, Goethestrasse 29, D-80336 RefLoc Munchen, Germany. RefNumber [2] RefCrossRef MEDLINE; 98118357 RefAuthors Holinski-Feder, E., Weiss M., Brandau, O., Jedele, K. B., RefAuthors Nore, B., Beckesj", C.-M., Vihinen, M., G"tz, G., Hubbard, RefAuthors S. R., Belohradsky, B. H., Smith, C. I. E., Meindl, A. RefTitle Mutation screening of the btk gene in 56 families with RefTitle X-linked agammaglobulinemia (XLA) - 47 unique mutations RefTitle without correlation to clinical course RefLoc Pediatrics 101:276-284(1998) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 64696 Feature /change: g -> a Feature /genomic_region: intron; 14 Feature /RE: +Sse9I, +TasI, +Tsp509I, +TspEI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: unknown Feature /inexloc:+5 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /domain: PH Sex XY // ID BTK_HUMAN; ;Intron 14; NX Occurrence 1/1 Accession K272 DBCrossRef BTKbase:A0279 Original code WKZ-11; Intron 15(3) Description point mutation at intron 14 Date 22-Apr-1996 (Rel. 3, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (22-Apr-1996) to the BTKbase. RefLoc Dr. Rik A. Brooimans, Wilhelmina Kinderziekenhuis, RefLoc Postbus 18009,3501 CA Utrecht, The Netherlands, RefLoc e-mail R.Brooimans@wkz.ruu.nl. RefNumber [2] RefCrossRef MEDLINE; 97335603 RefAuthors Brooimans, R.A., van den Berg, J.A.M., Rijkers, G.T., RefAuthors Sanders, L.A.M., van Amstel, J.K.P., Tilanus, M.G.J., RefAuthors Grubben, M.J.A.L., Zegers, B.J.M. RefTitle Identification of novel Bruton's tyrosine kinase mutations RefTitle in 10 unrelated subjects with X linked agammaglobulinemia RefLoc J. Med. Genet. 34: 484-488(1997) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 64696 Feature /change: g -> a Feature /genomic_region: intron; 14 Feature /RE: +Sse9I, +TasI, +Tsp509I, +TspEI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: gain of exon sequence; frameshift Feature /loc:EMBL: X58957; G312467; HSATK: 1481 Feature /change: + gtgaattata gcccaaactc aactctcaat ctatttgctg Feature /change: gagtctagga attcacacaa caacccactg aggcttaaag Feature /change: atgacttaca Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 451 Feature /change: N -> X Feature /domain: TK Protein struct premature stop Symptoms classical XLA Sex XY Age 2 Family history inherited IgA 0 IgG 0 IgM 0 B cells surf Ig <1 // ID BTK_HUMAN; ;Intron 14; GGIFPMRSWCSCMASAPSSAPSSSSLSTWPMAASX Occurrence 1/1 Accession K273 DBCrossRef BTKbase:A0419 Description point mutation at intron 14 Date 15-Sep-1996 (Rel. 5, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 3) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 97335603 RefAuthors Brooimans, R.A., van den Berg, J.A.M., Rijkers, G.T., RefAuthors Sanders, L.A.M., van Amstel, J.K.P., Tilanus, M.G.J., RefAuthors Grubben, M.J.A.L., Zegers, B.J.M. RefTitle Identification of novel Bruton's tyrosine kinase mutations RefTitle in 10 unrelated subjects with X linked agammaglobulinemia RefLoc J. Med. Genet. 34: 484-488(1997) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 64692 Feature /change: g -> t Feature /genomic_region: intron; 14 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: loss of exon sequence; frameshift Feature /loc:EMBL: X58957; G312467; HSATK: 1310..1481 Feature /change: - gatcatggga aattgatcca aaggacctga ccttcttgaa Feature /change: ggagctgggg actggacaat ttggggtagt gaagtatggg Feature /change: aaatggagag gccagtacga cgtggccatc aagatgatca Feature /change: aagaaggctc catgtctgaa gatgaattca ttgaagaagc Feature /change: caaagtcatg at Feature /note: deletion of exon 14 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 393 Feature /change: G ->GIFPMRSWCSCMASAPSSAPSSSSLSTWPMAASX Feature /domain: TK Protein struct premature stop // ID BTK_HUMAN; ;Intron 15; AVCPGX Occurrence 1/1 Accession K274 DBCrossRef BTKbase:A0039 Original code P22 Description deletion at intron 15 leading to a large deletion of Description protein Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 94377492 RefAuthors Ohta, Y., Haire, R. N., Litman, R. T., Shu, M. F., Nelson, RefAuthors R. P., Kratz, J., Kornfeld, S. J., De La Morena, M., Good, RefAuthors R. A., Litman, G. W. RefTitle Genomic organization and structure of Bruton RefTitle agammaglobulinemia tyrosine kinase: Localization of RefTitle mutations associated with varied clinical presentations and RefTitle cource in X chromosome-linked agammaglobulinemia RefLoc Proc. Natl. Acad. Sci. 91:9062-9066(1994) Feature dna; 1 Feature /rnalink: 2 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 66769..66772 Feature /change: -tttg Feature /genomic_region: intron; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: loss of exon sequence; frameshift Feature /loc:EMBL: X58957; G312467; HSATK: 1567..1631 Feature /change: - gcagctcgaa actgtttggt aaacgatcaa ggagttgtta Feature /change: aagtatctga tttcggcct gtccag Feature /note: exon 16 deletion Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 523 Feature /change: A -> VCPGX Feature /domain: TK Protein struct large deletion Symptoms moderate XLA Sex XY Age 1.4 Family history inherited IgA 0.17 IgG 4.08 IgM 0.42 CD20 10 Comment -!-Symptoms: recurrent URI // ID BTK_HUMAN; ;Intron 15; DQGVVKVSDFGLSRY Occurrence 1/1 Accession K275 DBCrossRef BTKbase:A0185 Original code 23 Description deletion at intron 15 leading to a large deletion of Description protein Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (24-May-1995) to the BTKbase. RefLoc Dr. Hans D. Ochs, Dept of Pediatrics, University of RefLoc Washington, Seattle, WA 98195, USA, RefLoc e-mail allgau@u.washington.edu. Feature dna; 1 Feature /rnalink: 2 Feature /name: deletion; unknown Feature /changeLenght: -4 Feature /genomic_region: intron; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: loss of exon sequence; inframe Feature /loc:EMBL: X58957; G312467; HSATK: 1350..1631 Feature /change: - gaatctttcc catgagaagc tggtgcagtt gtatggcgtc Feature /change: tgcaccaagc agcgccccat cttcatcatc actgagtaca Feature /change: tggccaatgg ctgcctcctg aactacctga gggagatgcg Feature /change: ccaccgcttc cagactcagc agctgctaga gatgtgcaag Feature /change: gatgtctgtg aagccatgga atacctggag tcaaagcagt Feature /change: tccttcaccg agacctggca gctcgaaact gtttggtaaa Feature /change: cgatcaagga gttgttaaag tatctgattt cggcctgtcc ag Feature /note: deletion of exons 15 and 16 Feature aa; 3 Feature /rnalink: 2 Feature /name: inframe deletion Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 451..545 Feature /change: -NLSHEKLVQL YGVCTKQRPI FIITEYMANG CLLNYLREMR Feature /change: HRFQTQQLLE MCKDVCEAME YLESKQFLHR DLAARNCLVN Feature /change: DQGVVKVSDF GLSRY Feature /domain: TK Protein struct large deletion Sex XY Family history inherited // ID BTK_HUMAN; ;Intron 15; gt Occurrence 1/1 Accession K276 DBCrossRef BTKbase:A0405 Original code H Description point mutation at intron 15 leading to aberrant splicing Date 02-Jan-1997 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (01-Jan-1997) to the BTKbase. RefLoc Dr. C.I.E. Smith, Center for BioTechnology, Department of RefLoc Biosciences at Novum, Karolinska Institute, S-14157 RefLoc Huddinge, Sweden, e-mail edvard.smith@cbt.ki.se Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 65424 Feature /change: g -> t Feature /genomic_region: intron; 15 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: unknown Feature /inexloc:+1 Feature aa; 3 Feature /rnalink: 2 Feature /name: unknown Feature /domain: TK // ID BTK_HUMAN; ;Intron 16; gt Occurrence 1/1 Accession K277 DBCrossRef BTKbase:A0102 Original code 20 Description point mutation at intron 16 Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 7) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95152494 RefAuthors Conley, M. E., Fitch-Hilgenberg, M. E., Cleveland, J. L. RefAuthors Parolini, O., Rohrer, J. RefTitle Screening of genomic DNA to indentify mutations in the RefTitle gene for Bruton's tyrosine kinase RefLoc Hum. Molec. Genet. 3: 1751-1756(1994) DB CrossRef OMIM; 300300.0041 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 66846 Feature /change: g -> t Feature /genomic_region: intron; 16 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: unknown Feature /inexloc:+1 Feature aa; 3 Feature /rnalink: 2 Feature /name: unknown Feature /domain: TK Symptoms classical XLA Sex XY Family history inherited B cells surf Ig <1 // ID BTK_HUMAN; ;Intron 16; RSX Occurrence 1/1 Accession K278 DBCrossRef BTKbase:A0146 Original code 56; KNU Description point mutation at intron 16 leading to large insertion Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95359977 RefAuthors Jin, H., Webster, A. D. B., Vihinen, M., Sideras, P., RefAuthors Vorechovsky, I., Hammarstrom, L., RefAuthors Bernatowska-Matuszkiewicz, E., Smith, C. I. E., Bobrow, M., RefAuthors Vetrie, D. RefTitle Identification of Btk mutations in 20 unrelated patients RefTitle with X-linked agammaglobulinemia (XLA) RefLoc Hum. Molec. Genet. 4: 693-700(1995) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 66846 Feature /change: g -> c Feature /genomic_region: intron; 16 Feature /RE: +AluI, +BstDEI, +CviJI, +CviJI, +DdeI, +MspA1I, Feature /RE: +MwoI, +NspBII, +PvuII, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: gain of exon sequence; frameshift Feature /loc: EMBL: X58957; G312467; HSATK: 1764 Feature /change: + ctgagtgtgg ctttttcatc tttccctcca gaagtaaaaa Feature /change: tagcacagta tgaaacatgg Feature /note: insertion of exon 16a Feature /inexloc: +1 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 544 Feature /change: R -> SX Feature /domain: TK Protein struct large insertion Symptoms classical XLA Sex XY Family history inherited B cells surf Ig <1 // ID BTK_HUMAN; ;Intron 16; gt Occurrence 1/1 Accession K279 DBCrossRef BTKbase:A0189 Description point mutation at intron 16 Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (01-Jun-1995) to the BTKbase. RefLoc Patrizia Melia, Roberta Giuliani and Maurilia Florini, RefLoc Dept. of Pediatrics and Institute of Chemistry, RefLoc University of Prescia I-25123 Brescia, Italy. Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 66846 Feature /change: g -> t Feature /genomic_region: intron; 16 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: unknown Feature /inexloc:+1 Feature aa; 3 Feature /rnalink: 2 Feature /name: unknown Feature /domain: TK Protein struct aberrant splicing Sex XY Age 3 Family history inherited IgA < 0.066 IgG 2.00 IgM 0.082 CD19 <1 CD20 <1 Comment -!-Family history: mother carrier // ID BTK_HUMAN; ;Intron 16; gt Occurrence 1/1 Accession K280 DBCrossRef BTKbase:A0249 Original code MS Description mutation at intron 16 leading to aberrant splicing Date 02-Feb-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 97288998 RefAuthors Vorechovsky, I., Luo, L., Hertz., J. M., Froland, S. S., RefAuthors Fiorini, N., Quinti, I., Paganelli, R., Segers, R., RefAuthors Hammarstrom, L., Webster, A. D. B., Smith, C. I. E. RefTitle Mutation pattern in the Bruton's tyrosine kinase gene in RefTitle 26 unrelated patients with X-linked agammaglobulinemia RefLoc Hum. Mut. 9:418-425 (1997) DB CrossRef ESID; IT 0436 MXX G1 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 66846 Feature /change: g -> t Feature /genomic_region: intron; 16 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: unknown Feature /inexloc:+1 Feature aa; 3 Feature /rnalink: 2 Feature /name: unknown Feature /domain: TK Protein struct aberrant splicing Sex XY Family history inherited // ID BTK_HUMAN; ;Intron 16; gt Occurrence 1/1 Accession K281 DBCrossRef BTKbase:A0468 Original code 20.17; Intron 16(2) Description point mutation at intron 16 Date 21-Apr-1998 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 8) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 97092684 RefAuthors Farrar, J. E., Rohrer, J., Conley, M. E. RefTitle Neutropenia in X-linked agammaglobulinemia RefLoc Clin. Immunol. Immunopathol. 81:271-276(1996) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 66846 Feature /change: g -> t Feature /genomic_region: intron; 16 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: unknown Feature /inexloc:+1 Feature aa; 3 Feature /rnalink: 2 Feature /name: unknown Feature /domain: TK Symptoms classical XLA Sex XY Family history inherited B cells surf Ig <1 Comment -!-:Symptoms: neutropenia // ID BTK_HUMAN; ;Intron 16; RSX Occurrence 1/1 Accession K282 DBCrossRef BTKbase:A0319 Original code P31; @Y545+20(1) Description point mutation at intron 16 leading to large insertion Date 19-Aug-1996 (Rel. 4, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 2) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 96289505 RefAuthors Hashimoto, S., Tsukada, S., Matsushita, M., Miyawaki, T., RefAuthors Niida, Y., Yachie, A., Kobayashi, S., Iwata, T., RefAuthors Hayakawa, H., Matsuoka, H., Tsuge, I., Yamadori, T., RefAuthors Kunikata, T., Arai, S., Yoshizaki, K., Taniguchi, N., RefAuthors Kishimoto, T. RefTitle Identification of Bruton's tyrosine kinase (Btk) gene RefTitle mutations and characterization of the derived proteins in RefTitle 35 X-linked agammaglobulinemia families: a nationwide RefTitle study of Btk deficiency in Japan RefLoc Blood 88:561-573(1996) RefNumber [2] RefCrossRef MEDLINE; 98102441 RefAuthors Futatani, T., Miyawaki, T., Tsukada, S., Hashimoto, S., RefAuthors Kunikata, T., Arai, S., Kurimoto, T., Niida, Y., Matsuoka, RefAuthors H., Sakiyama, Y., Iwata, T., Tsuchiya, S., Tatsuzawa, O., RefAuthors Yoshizaki, K., Kishimoto, T. RefTitle Deficient expression of Bruton's tyrosine kinase in RefTitle monocytes from X-linked agammaglobulinemia as evaulated by RefTitle a flow cytometric analysis and its clinical application to RefTitle carrier detection RefLoc Blood 91:595-602(1998) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 66846 Feature /change: g -> c Feature /genomic_region: intron; 16 Feature /RE: +AluI, +BstDEI, +CviJI, +CviJI, +DdeI, +MspA1I, Feature /RE: +MwoI, +NspBII, +PvuII, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: gain of exon sequence; frameshift Feature /loc: EMBL: X58957; G312467; HSATK: 1764 Feature /change: + ctgagtgtgg ctttttcatc tttccctcca gaagtaaaaa Feature /change: tagcacagta tgaaacatgg Feature /inexloc: +1 Feature aa; 3 Feature /rnalink: 2 Feature /name: Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 544 Feature /change: R -> SX Feature /domain: TK Protein level absent; ref [2] Kinase activity inactive; ref [2] Sex XY Age 6 Ethnic origin Mongoloid; Japan Family history inherited IgA < 0.05 IgG < 0.50 IgM 0.07 B cells surf Ig 0.6 Comment -!-Family history: two affected cousins // ID BTK_HUMAN; ;Intron 17; ga Occurrence 1/1 Accession K283 DBCrossRef BTKbase:A0266 Original code 22.2; Splice 17(1) Description mutation at intron 17 leading to splice defect Date 09-Jan-1996 (Rel. 3, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 96007207 RefAuthors Conley, M. E., Rohrer, J. RefTitle The spectrum of mutations in Btk that cause X-linked RefTitle agammaglobulinemia RefLoc Clin. Immunol. Immunopathol. 76:S192-S197(1995) Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68124 Feature /change: g -> a Feature /genomic_region: intron; 17 Feature /RE: +BstDEI, +DdeI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: unknown Feature /inexloc:-1 Feature aa; 3 Feature /rnalink: 2 Feature /name: unknown Feature /domain: TK Symptoms mild XLA Sex XY Family history inherited // ID BTK_HUMAN; ;Intron 17; +t Occurrence 1/1 Accession K284 DBCrossRef BTKbase:A0391 Description insertion at intron 17 leading to aberrant splicing Date 15-May-1997 (Rel. 5, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (27-Aug-1996) to the BTKbase. RefLoc Dr. Michael Weiss, prof. Dr. Bernd H. Belohradsky, RefLoc Abteilung fur Infektionsimmunologia, Dr. von Haunersches RefLoc Kinderspital Klinikum Innenstadt der Universitat, Munchen, RefLoc Lindwurmstrasse 4, D-80337 Munchen, Germany, RefLoc FAX 498 951 604 928. RefLoc Dr. Elke Holinski-Feder, Dr. Alfons Meindl, Abteilung fur RefLoc Padiatrische Genetik Kinderpoliklinik, Klinikum Innenstadt RefLoc der Universitat, Munchen, Goethestrasse 29, D-80336 RefLoc Munchen, Germany. RefNumber [2] RefCrossRef MEDLINE; 98118357 RefAuthors Holinski-Feder, E., Weiss M., Brandau, O., Jedele, K. B., RefAuthors Nore, B., Beckesj", C.-M., Vihinen, M., G"tz, G., Hubbard, RefAuthors S. R., Belohradsky, B. H., Smith, C. I. E., Meindl, A. RefTitle Mutation screening of the btk gene in 56 families with RefTitle X-linked agammaglobulinemia (XLA) - 47 unique mutations RefTitle without correlation to clinical course RefLoc Pediatrics 101:276-284(1998) Feature dna; 1 Feature /rnalink: 2 Feature /name: insertion Feature /loc: EMBL: Hsu78027: 67608 Feature /change: +t Feature /genomic_region: intron; 17 Feature /RE: +MseI, +Tru1I, +Tru9I, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: unknown Feature /inexloc:+3 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /domain: PH Sex XY // ID BTK_HUMAN; ;Intron 17; -ERFTNSETAEHIAQGLRLYRPHLASEKVYT Occurrence 1/1 Accession K285 DBCrossRef BTKbase:A0029 Original code Intron 16(1) Description mutation at intron 17 leading to deletion of part of the Description C-terminal residues of the protein Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 7) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 94283589 RefAuthors Duriez, B., Duquesnoy, P., Dastot, F., Bougneres, P., RefAuthors Amselem, S., Goossens, M. RefTitle An exon-skipping mutation in the btk gene of a patient RefTitle with X-linked agammaglobulinemia and isolated growth RefTitle hormone deficiency RefLoc FEBS Letters 346:165-170(1994) DB CrossRef OMIM; 300300.0004 Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 67610 Feature /change: g -> a Feature /genomic_region: intron; 17 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: loss of exon sequence; frameshift Feature /loc: EMBL: X58957; G312467; HSATK: 1763..1882 Feature /change: - gtatgtcctg gatgatgaat acacaagctc agtaggctcc Feature /change: aaatttccag tccggtggtc cccaccggaa gtcctgatgt Feature /change: atagcaagtt cagcagcaaa tctgacattt gggcttttg Feature /note: deletion of exon 17 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 599..659 Feature /change: -ERFTNSETAE HIAQGLRLYR PHLASEKVYT Feature /domain: TK Protein struct premature stop Symptoms classical XLA Sex XY Age 2 Family history inherited IgA 0.05 IgG 0.08 IgM 0.05 Comment -!-Symptoms: isolated growth hormone deficiency // ID BTK_HUMAN; ;Intron 17; gc Occurrence 1/1 Accession K286 DBCrossRef BTKbase:A0444 Original code G15645 Description mutation at intron 17 Date 07-Sep-1997 (Rel. 5, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (07-Sep-1997) to the BTKbase. RefLoc Dr. Tracy Lester, Unit of Clinical Genetics, Institute RefLoc of Child Health, 30 Guilford Street, London, WC1N 1EH, RefLoc Tel 0171 242 9789 ext 2284, Fax 0171 404 6191 RefLoc e-mail T.Lester@ich.ucl.ac.uk Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68124 Feature /change: g -> c Feature /genomic_region: intron; 17 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /inexloc: -1 Feature aa; 3 Feature /rnalink: 2 Feature /domain: TK Sex XY Ethnic origin Caucasoid; UK Family history inherited // ID BTK_HUMAN; ;Intron 17; gc Occurrence 2/2 Accession K287 DBCrossRef BTKbase:A0528 Original code G16343a Description point mutation at intron 17 Date 19-Oct-1998 (Rel. 6, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (19-Oct-1998) to BTKbase. RefLoc Dr. Tracy Lester, Clinical Molecular Genetics Laboratory, RefLoc Level 5, Camelia Botnar Laboratories, Great Ormond Street RefLoc Hospital for Children NHS Trust, Great Ormond Street, RefLoc London, WC1N 3JH, RefLoc e-mail tracy.lester@gosh-tr.nthames.nhs.uk Feature dna; 1 Feature /rnalink; 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68124 Feature /change: g -> c Feature /genomic_region: intron; 17 Feature rna; 2 Feature /dnalink; 1 Feature /aalink; 3 Feature /name: unknown Feature /inexloc:-1 Feature aa; 3 Feature /rnalink: 2 Feature /name: unknown Feature /domain: TK Symptoms classical XLA Sex XY Family history inherited Ethnic origin - ; Portugal CD19 0 // ID BTK_HUMAN; ;Intron 18; -KADERPTFKILLSNILDVMDEES Occurrence 1/1 Accession K289 DBCrossRef BTKbase:A0126 Original code 29/2 Description mutation at intron 18 causing deletion of exon 19 Date 30-May-1995 (Rel. 1, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95227177 RefAuthors Vorechovsky, I., Vihinen, M., de Saint Basile, G., Honsova, RefAuthors S., Hammarstrom, L., Muller, S., Nilsson, L., Fischer, A., RefAuthors Smith, C. I. E. RefTitle DNA-based mutation analysis of Bruton's tyrosine gene RefTitle in patients with X-linked agammaglobulinemia RefLoc Hum. Molec. Genet. 4(1):51-58(1995) Feature dna; 1 Feature /rnalink: 2 Feature /genomic_region: intron; 18 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /loc: EMBL: X58957; G312467; HSATK: 1909..1980 Feature /name: loss of exon sequence; inframe Feature /change: - aaagcagatg agcgtcccac tttcaaaatt cttctgagca Feature /change: atattctaga tgtcatggat gaagaatcct ga Feature /note: deletion of exon 19 Feature aa; 3 Feature /rnalink: 2 Feature /name: out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 636..659 Feature /change: -KADERPTFKI LLSNILDVMD EES Feature /domain: TK Protein struct premature stop Sex XY Family history inherited // ID BTK_HUMAN; ;Intron 18; GRSRX Occurrence 1/1 Accession K290 DBCrossRef BTKbase:A0156 Original code CHD; 13; #G584X587(1); G11466 Description frameshift deletion in the exon 18 leading to Description stop codon in TK domain Date 30-May-1995 (Rel. 5, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefCrossRef MEDLINE; 95359987 RefAuthors Gaspar, H. B., Bradley, L. A. D., Katz, F., Lovering, R. RefAuthors C., Roifman, C. M., Morgan, G., Levinsky, R. J., RefAuthors Kinnon, C. RefTitle Mutation analysis in Bruton's tyrosine kinase, the X- RefTitle linked agammaglobulinemia, including identification of an RefTitle insertional hotspot RefLoc Hum. Molec. Genet. 4: 755-757(1995) RefNumber [2] RefLoc Submitted (06-Sep-1996) to the BTKbase. RefLoc Dr. Tracy Lester, Unit of Clinical Genetics, Institute RefLoc of Child Health, 30 Guilford Street, London, WC1N 1EH, RefLoc Tel 0171 242 9789 ext 2284, Fax 0171 404 6191 RefLoc e-mail T.Lester@ich.ucl.ac.uk Feature dna; 1 Feature /rnalink: 2 Feature /name: deletion Feature /loc: EMBL: Hsu78027: unknown Feature /change: unknown Feature /genomic_region: intron; 18 Feature /RE: +FauI, Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: loss of exon sequence; frameshift Feature /loc: EMBL: X58957; G312467; HSATK: 2015..2172 Feature /change: - gggttttgat gtgggaaatt tactccctgg ggaagatgcc Feature /change: atatgagaga tttactaaca gtgagactgc tgaacacatt Feature /change: gcccaaggcc tacgtctcta caggcctcat ctggcttcag Feature /change: agaaggtata taccatcatg tacagttgtt ggcatgag Feature /note: deletion of exon 18 Feature aa; 3 Feature /rnalink: 2 Feature /name:out of frame translation; premature termination Feature /loc: SWISSPROT: Q06187; BTK_HUMAN: 584 Feature /change: G-> RSRX Feature /domain: TK mRNA level aberrant splicing of exon 18 Symptoms classical XLA Sex XY Family history inherited, no ? B cells surf Ig <1 // ID BTK_HUMAN; ;Intron 18; ga Occurrence 2/2 Accession K291 DBCrossRef BTKbase:A0396 Original code X11 Description mutation and an inframe_deletion at intron 18 leading to Description deletion of Date 02-Jan-1997 (Rel. 5, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (02-Jan-1997) to the BTKbase. RefLoc Dr. Bratin K. Saha, Department of Pathology and RefLoc Laboratory Medicine, 69 Butler St. SE RefLoc Atlanta, GA 30303-3219, e-mail bsaha@emory.edu. RefLoc Fax: (404) 616-7455. RefNumber [2] RefCrossRef MEDLINE; 97406776 RefAuthors Saha, B. K., Curtis S. K., Voles, L. B., Vihinen, M. RefTitle Molecular and structural characterization of five RefTitle novel mutations in the Bruton's tyrosine kinase gene RefTitle from patients with X-linked agammaglobulinemia RefLoc Molec. Med. 3:477-485(1997) Feature dna; 1 Feature /rnalink: 2 Feature /name: deletion Feature /loc: EMBL: Hsu78027: 68283 Feature /change: g -> a Feature /genomic_region: intron; 18 Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /name: unknown Feature /inexloc: +1 Feature aa; 3 Feature /rnalink: 2 Feature /name: unknown Feature /domain: TK Symptoms classical XLA Sex XY Age 1 Family history inherited Relative BTK; A0397; brother // ID BTK_HUMAN; ;Intron 18; gt Occurrence 3/3 Accession K293 DBCrossRef BTKbase:A0445 Original code G6976a Description mutation at intron 18 Date 07-Sep-1997 (Rel. 5, Created) Date 13-Apr-1999 (Rel. 7, Last updated, Version 1) Disease Agammaglobulinemia RefNumber [1] RefLoc Submitted (07-Sep-1997) to the BTKbase. RefLoc Dr. Tracy Lester, Unit of Clinical Genetics, Institute RefLoc of Child Health, 30 Guilford Street, London, WC1N 1EH, RefLoc Tel 0171 242 9789 ext 2284, Fax 0171 404 6191 RefLoc e-mail T.Lester@ich.ucl.ac.uk Feature dna; 1 Feature /rnalink: 2 Feature /name: point Feature /loc: EMBL: Hsu78027: 68283 Feature /change: g -> t Feature /genomic_region: intron; 18 Feature /RE: +MseI, +MseI, -MseI, -MseI, +Tru1I, +Tru1I, Feature /RE: -Tru1I, -Tru1I, +Tru9I, +Tru9I, -Tru9I, -Tru9I, Feature /RE: Feature rna; 2 Feature /dnalink: 1 Feature /aalink: 3 Feature /inexloc: +1 Feature aa; 3 Feature /rnalink: 2 Feature /domain: TK Symptoms classical XLA Sex XY Age 3 Ethnic origin Caucasoid; Australia Family history inherited Relative BTK; A0446; second cousin Relative BTK; A0447; second cousin Comment -!-Symptoms: lower RTI from 10 months IgA < 0.07 IgG 6.91 IgM < 0.09 CD19 0 //